| Clone Name | rbasd16i22 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | FNDC3_HUMAN (Q9Y2H6) Fibronectin type-III domain-containing prot... | 32 | 1.3 | 2 | PYRG_CHLTR (Q59321) CTP synthase (EC 6.3.4.2) (CTP synthase) (UT... | 30 | 6.6 |
|---|
>FNDC3_HUMAN (Q9Y2H6) Fibronectin type-III domain-containing protein 3a| Length = 1134 Score = 32.3 bits (72), Expect = 1.3 Identities = 32/120 (26%), Positives = 48/120 (40%), Gaps = 1/120 (0%) Frame = -2 Query: 422 VPTQAVDLREIRFDEIDDEYIVTGAVPSMSTPGRMASFHYRDTRYGR*SAHYLIEPADKE 243 VP L+EI DEI++ P S +A + +G Y I+ DK+ Sbjct: 788 VPGIVTCLQEISDDEIEN--------PHYSPSTCLAISWEKPCDHGSEILAYSIDFGDKQ 839 Query: 242 RDLQPRFDAAAIRKLYPLLVF-VSFPARSLLGAAPAPDFLCIKSSNRNPPPPSLVCNRFS 66 + + I L P + + A + LGA P + +K+ P PP L C FS Sbjct: 840 SLTVGKVTSYIINNLQPDTTYRIRIQALNSLGAGPFSHMIKLKTKPLPPDPPRLECVAFS 899
>PYRG_CHLTR (Q59321) CTP synthase (EC 6.3.4.2) (CTP synthase) (UTP--ammonia| ligase) Length = 539 Score = 30.0 bits (66), Expect = 6.6 Identities = 31/110 (28%), Positives = 44/110 (40%), Gaps = 2/110 (1%) Frame = -2 Query: 449 AHLENFNLEVPTQAVDLREIRFDEIDDEYIVTGAVPSMSTPGRMASFHYR-DTRYGR*SA 273 A+ N E P V + E + + + GA P PG +AS Y+ D R Sbjct: 400 ANSMEINPETPDPVVCMMEGQDSVVKGGTMRLGAYPCRIAPGSLASAAYKTDLVQERHRH 459 Query: 272 HYLIEPADKERDLQPRFDAAAIRKLYPLLVFVSFP-ARSLLGAAPAPDFL 126 Y + P+ ER + A + L L V P R +LG P+FL Sbjct: 460 RYEVNPSYIERLEEHGLKIAGVCPLGELCEIVEIPNHRWMLGVQFHPEFL 509 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 86,299,361 Number of Sequences: 219361 Number of extensions: 1749321 Number of successful extensions: 4386 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4121 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4365 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6541540170 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)