| Clone Name | rbasd16f22 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | MOS_CERAE (P10650) Proto-oncogene serine/threonine-protein kinas... | 30 | 4.4 | 2 | SRP_DROME (P52172) Box A-binding factor (ABF) (GATA-binding fact... | 30 | 4.4 | 3 | CYAA_PASMU (Q05766) Adenylate cyclase (EC 4.6.1.1) (ATP pyrophos... | 29 | 7.6 | 4 | FCRL_RAT (Q3B8P2) Fc receptor-like and mucin-like 1 precursor | 29 | 9.9 |
|---|
>MOS_CERAE (P10650) Proto-oncogene serine/threonine-protein kinase mos (EC| 2.7.11.1) (c-mos) (Oocyte maturation factor mos) Length = 346 Score = 30.0 bits (66), Expect = 4.4 Identities = 14/28 (50%), Positives = 17/28 (60%) Frame = +1 Query: 412 RPFLPTNFTPSVSQR*CSLISSPPLTYL 495 RP+LP+ F+PSV R CS S P L Sbjct: 8 RPYLPSEFSPSVDARPCSSPSELPAKLL 35
>SRP_DROME (P52172) Box A-binding factor (ABF) (GATA-binding factor-B)| (Transcription factor GATA-B) (dGATA-B) (Protein serpent) Length = 1264 Score = 30.0 bits (66), Expect = 4.4 Identities = 23/114 (20%), Positives = 49/114 (42%), Gaps = 6/114 (5%) Frame = +1 Query: 205 NLQAEALWNNEDNNSIKLCTSRESVVRDHDLAEGWGLETRTLSFEGPDLVLLLFRSALME 384 N +++NN +NN+ + +++ + A+ + + S L+ L +++ Sbjct: 1028 NNNNSSIFNNNNNNNSSSNENNNKLIQKYLQAQQLSSSSNSGSTSDHQLLAQLLPNSITA 1087 Query: 385 AITASAPGPRPFLPTNFTPSVSQR*CS------LISSPPLTYLSSIACCRDSNV 528 A A+A + T SQ CS +++S P T S+++ SN+ Sbjct: 1088 AAAAAAAAAAAAIKTEALSLTSQANCSTASAGLMVTSTPTTASSTLSSLSHSNI 1141
>CYAA_PASMU (Q05766) Adenylate cyclase (EC 4.6.1.1) (ATP pyrophosphate-lyase)| (Adenylyl cyclase) Length = 838 Score = 29.3 bits (64), Expect = 7.6 Identities = 15/33 (45%), Positives = 19/33 (57%) Frame = +1 Query: 316 ETRTLSFEGPDLVLLLFRSALMEAITASAPGPR 414 E RTL FEGP+ +LL + L I AP P+ Sbjct: 608 EIRTLHFEGPNAILLALK-VLSNKIHRGAPSPK 639
>FCRL_RAT (Q3B8P2) Fc receptor-like and mucin-like 1 precursor| Length = 347 Score = 28.9 bits (63), Expect = 9.9 Identities = 26/65 (40%), Positives = 32/65 (49%), Gaps = 6/65 (9%) Frame = +1 Query: 316 ETRTLSFEGPDLVLLLFRSALMEAIT------ASAPGPRPFLPTNFTPSVSQR*CSLISS 477 E R +S + P+L + + AL + T A APGP P LP TPS Q S S Sbjct: 252 EDRQISKQSPELEIRV--QALQKPATPETPPPAKAPGPLPLLP---TPSDEQPVFS-FSD 305 Query: 478 PPLTY 492 P LTY Sbjct: 306 PYLTY 310 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 74,189,844 Number of Sequences: 219361 Number of extensions: 1468331 Number of successful extensions: 3373 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 3294 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3370 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4373119116 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)