| Clone Name | rbasd16e20 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ARNT2_MOUSE (Q61324) Aryl hydrocarbon receptor nuclear transloca... | 32 | 2.4 | 2 | ARNT2_HUMAN (Q9HBZ2) Aryl hydrocarbon receptor nuclear transloca... | 32 | 2.4 | 3 | WCAC_ECOLI (P71237) Putative colanic acid biosynthesis glycosyl ... | 30 | 7.0 |
|---|
>ARNT2_MOUSE (Q61324) Aryl hydrocarbon receptor nuclear translocator 2 (ARNT| protein 2) Length = 712 Score = 31.6 bits (70), Expect = 2.4 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = +2 Query: 446 WKAQAHGQMHSFEHAPSDPSRTEMFQ 523 W++Q HGQ +H+ P +TE+FQ Sbjct: 655 WQSQHHGQQSGEQHSHQQPGQTEVFQ 680
>ARNT2_HUMAN (Q9HBZ2) Aryl hydrocarbon receptor nuclear translocator 2 (ARNT| protein 2) Length = 706 Score = 31.6 bits (70), Expect = 2.4 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = +2 Query: 446 WKAQAHGQMHSFEHAPSDPSRTEMFQ 523 W++Q HGQ +H+ P +TE+FQ Sbjct: 649 WQSQHHGQQSGEQHSHQQPGQTEVFQ 674
>WCAC_ECOLI (P71237) Putative colanic acid biosynthesis glycosyl transferase| wcaC Length = 405 Score = 30.0 bits (66), Expect = 7.0 Identities = 17/74 (22%), Positives = 31/74 (41%), Gaps = 21/74 (28%) Frame = +1 Query: 256 IHKYIYIHNWMDLRSIVKACER----------------QWQHEQGCSTLD-----KFSCV 372 +H ++ W++L+S+V+ CE+ W C+ D K C Sbjct: 98 LHFHVLHSYWLNLKSVVRFCEKVKNHKPDVTLVWTLHDHWSVTGRCAFTDGCEGWKTGCQ 157 Query: 373 ECPRLCHATTIKVD 414 +CP L + +K+D Sbjct: 158 KCPTLNNYPPVKID 171 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 93,384,703 Number of Sequences: 219361 Number of extensions: 1924995 Number of successful extensions: 4434 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4332 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4433 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6882837918 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)