| Clone Name | rbasd15k06 |
|---|---|
| Clone Library Name | barley_pub |
>GAG_MPMV (P07567) Gag polyprotein (Core polyprotein) [Contains: Core protein| p10; Core phosphoprotein pp24; Core protein p12; Core protein p27; Core protein p14; Core protein p4] Length = 656 Score = 39.7 bits (91), Expect = 0.002 Identities = 17/34 (50%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Frame = -1 Query: 311 GGGCFSCGESGHFSRECPNKAH*AAQP-VRSECP 213 GG CF CG+ GHF++ C AH A+P V CP Sbjct: 545 GGCCFKCGKKGHFAKNCHEHAHNNAEPKVPGLCP 578
>GRP2_NICSY (P27484) Glycine-rich protein 2| Length = 214 Score = 39.3 bits (90), Expect = 0.003 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = -1 Query: 311 GGGCFSCGESGHFSREC 261 GGGC+ CGE GHF+REC Sbjct: 193 GGGCYKCGEDGHFAREC 209 Score = 38.5 bits (88), Expect = 0.004 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = -1 Query: 311 GGGCFSCGESGHFSREC 261 G GCF CGESGHF+R+C Sbjct: 156 GSGCFKCGESGHFARDC 172
>HEXP_LEIMA (Q04832) DNA-binding protein HEXBP (Hexamer-binding protein)| Length = 271 Score = 38.9 bits (89), Expect = 0.003 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 302 CFSCGESGHFSRECPNKA 249 CF CGE GH SRECPN+A Sbjct: 45 CFRCGEEGHMSRECPNEA 62 Score = 37.7 bits (86), Expect = 0.007 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = -1 Query: 302 CFSCGESGHFSRECPNKA 249 CF CGE+GH SR+CPN A Sbjct: 72 CFRCGEAGHMSRDCPNSA 89 Score = 35.8 bits (81), Expect = 0.028 Identities = 12/16 (75%), Positives = 14/16 (87%) Frame = -1 Query: 302 CFSCGESGHFSRECPN 255 C+ CGESGH SRECP+ Sbjct: 198 CYKCGESGHMSRECPS 213 Score = 35.0 bits (79), Expect = 0.048 Identities = 13/22 (59%), Positives = 17/22 (77%), Gaps = 3/22 (13%) Frame = -1 Query: 311 GGG---CFSCGESGHFSRECPN 255 GGG C+ CGE+GH SR+CP+ Sbjct: 249 GGGDRTCYKCGEAGHISRDCPS 270 Score = 34.3 bits (77), Expect = 0.081 Identities = 10/16 (62%), Positives = 14/16 (87%) Frame = -1 Query: 302 CFSCGESGHFSRECPN 255 C+ CG++GH SR+CPN Sbjct: 170 CYKCGDAGHISRDCPN 185 Score = 34.3 bits (77), Expect = 0.081 Identities = 10/16 (62%), Positives = 14/16 (87%) Frame = -1 Query: 302 CFSCGESGHFSRECPN 255 C+ CG++GH SR+CPN Sbjct: 142 CYKCGDAGHISRDCPN 157 Score = 32.3 bits (72), Expect = 0.31 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = -1 Query: 311 GGGCFSCGESGHFSRECPN 255 G C+ CG+ GH SR+CP+ Sbjct: 96 GFECYKCGQEGHLSRDCPS 114 Score = 32.0 bits (71), Expect = 0.40 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = -1 Query: 302 CFSCGESGHFSRECP 258 C+ CG+ GH SRECP Sbjct: 224 CYKCGKPGHISRECP 238 Score = 30.4 bits (67), Expect = 1.2 Identities = 9/15 (60%), Positives = 13/15 (86%) Frame = -1 Query: 302 CFSCGESGHFSRECP 258 C +CG+ GH++RECP Sbjct: 18 CRNCGKEGHYARECP 32
>GLH2_CAEEL (Q966L9) ATP-dependent RNA helicase glh-2 (EC 3.6.1.-) (Germline| helicase 2) Length = 974 Score = 38.1 bits (87), Expect = 0.006 Identities = 14/19 (73%), Positives = 15/19 (78%) Frame = -1 Query: 305 GCFSCGESGHFSRECPNKA 249 GCF+CGE GH S ECPN A Sbjct: 474 GCFNCGEQGHRSNECPNPA 492 Score = 27.7 bits (60), Expect = 7.6 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 302 CFSCGESGHFSRECPNK 252 C++C + GH SR+CP + Sbjct: 398 CYNCQQPGHNSRDCPEE 414 Score = 27.7 bits (60), Expect = 7.6 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 302 CFSCGESGHFSRECPNK 252 C++C + GH SR+CP + Sbjct: 284 CYNCQQPGHNSRDCPEE 300
>GLH1_CAEEL (P34689) ATP-dependent RNA helicase glh-1 (EC 3.6.1.-) (Germline| helicase 1) Length = 763 Score = 38.1 bits (87), Expect = 0.006 Identities = 14/19 (73%), Positives = 15/19 (78%) Frame = -1 Query: 305 GCFSCGESGHFSRECPNKA 249 GCF+CGE GH S ECPN A Sbjct: 263 GCFNCGEQGHRSNECPNPA 281
>GRP2B_ARATH (Q38896) Glycine-rich protein 2b (AtGRP2b)| Length = 201 Score = 36.2 bits (82), Expect = 0.021 Identities = 14/19 (73%), Positives = 17/19 (89%), Gaps = 2/19 (10%) Frame = -1 Query: 311 GGG--CFSCGESGHFSREC 261 GGG C+SCGESGHF+R+C Sbjct: 177 GGGLSCYSCGESGHFARDC 195 Score = 32.3 bits (72), Expect = 0.31 Identities = 13/20 (65%), Positives = 14/20 (70%), Gaps = 3/20 (15%) Frame = -1 Query: 311 GGG---CFSCGESGHFSREC 261 GGG CF CGE GH +REC Sbjct: 132 GGGDNSCFKCGEPGHMAREC 151
>GAG_SRV2 (P51516) Gag polyprotein (Core polyprotein) [Contains: Core protein| p10; Core phosphoprotein pp18; Core protein p12; Core protein p27; Core protein p14; Core protein p4] Length = 653 Score = 34.3 bits (77), Expect = 0.081 Identities = 10/16 (62%), Positives = 14/16 (87%) Frame = -1 Query: 308 GGCFSCGESGHFSREC 261 GGCF CG+ GHF+++C Sbjct: 543 GGCFKCGKKGHFAKDC 558
>LARK_DROME (Q94901) RNA-binding protein lark| Length = 352 Score = 34.3 bits (77), Expect = 0.081 Identities = 18/39 (46%), Positives = 25/39 (64%) Frame = -1 Query: 302 CFSCGESGHFSRECPNKAH*AAQPVRSECPVPLRSFSYR 186 C+ CG SGH+S+ECP + + +A R E P PL + YR Sbjct: 170 CYRCGRSGHWSKECP-RLYGSAGGGR-EPPSPLSAGGYR 206
>RBM4_BRARE (Q6IQ97) RNA-binding protein 4 (RNA-binding motif protein 4)| Length = 419 Score = 33.9 bits (76), Expect = 0.11 Identities = 10/16 (62%), Positives = 14/16 (87%) Frame = -1 Query: 305 GCFSCGESGHFSRECP 258 GC+ CG+ GH+S+ECP Sbjct: 161 GCYRCGQEGHWSKECP 176
>CNBP_RAT (P62634) Cellular nucleic acid-binding protein (CNBP) (Zinc finger| protein 9) Length = 177 Score = 33.9 bits (76), Expect = 0.11 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = -1 Query: 302 CFSCGESGHFSRECP 258 CF CG SGH++RECP Sbjct: 6 CFKCGRSGHWARECP 20 Score = 31.6 bits (70), Expect = 0.53 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = -1 Query: 302 CFSCGESGHFSRECPNKA 249 C+ CGESGH +REC +A Sbjct: 158 CYRCGESGHLARECTIEA 175 Score = 28.9 bits (63), Expect = 3.4 Identities = 8/14 (57%), Positives = 12/14 (85%) Frame = -1 Query: 302 CFSCGESGHFSREC 261 C+ CGESGH +++C Sbjct: 54 CYRCGESGHLAKDC 67 Score = 28.1 bits (61), Expect = 5.8 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = -1 Query: 302 CFSCGESGHFSREC 261 C+SCGE GH ++C Sbjct: 119 CYSCGEFGHIQKDC 132 Score = 27.3 bits (59), Expect = 10.0 Identities = 7/14 (50%), Positives = 12/14 (85%) Frame = -1 Query: 302 CFSCGESGHFSREC 261 C++CG+ GH +R+C Sbjct: 98 CYNCGKPGHLARDC 111
>CNBP_PONPY (Q5R5R5) Cellular nucleic acid-binding protein (CNBP) (Zinc finger| protein 9) Length = 177 Score = 33.9 bits (76), Expect = 0.11 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = -1 Query: 302 CFSCGESGHFSRECP 258 CF CG SGH++RECP Sbjct: 6 CFKCGRSGHWARECP 20 Score = 31.6 bits (70), Expect = 0.53 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = -1 Query: 302 CFSCGESGHFSRECPNKA 249 C+ CGESGH +REC +A Sbjct: 158 CYRCGESGHLARECTIEA 175 Score = 28.9 bits (63), Expect = 3.4 Identities = 8/14 (57%), Positives = 12/14 (85%) Frame = -1 Query: 302 CFSCGESGHFSREC 261 C+ CGESGH +++C Sbjct: 54 CYRCGESGHLAKDC 67 Score = 28.1 bits (61), Expect = 5.8 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = -1 Query: 302 CFSCGESGHFSREC 261 C+SCGE GH ++C Sbjct: 119 CYSCGEFGHIQKDC 132 Score = 27.3 bits (59), Expect = 10.0 Identities = 7/14 (50%), Positives = 12/14 (85%) Frame = -1 Query: 302 CFSCGESGHFSREC 261 C++CG+ GH +R+C Sbjct: 98 CYNCGKPGHLARDC 111
>CNBP_HUMAN (P62633) Cellular nucleic acid-binding protein (CNBP) (Zinc finger| protein 9) Length = 177 Score = 33.9 bits (76), Expect = 0.11 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = -1 Query: 302 CFSCGESGHFSRECP 258 CF CG SGH++RECP Sbjct: 6 CFKCGRSGHWARECP 20 Score = 31.6 bits (70), Expect = 0.53 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = -1 Query: 302 CFSCGESGHFSRECPNKA 249 C+ CGESGH +REC +A Sbjct: 158 CYRCGESGHLARECTIEA 175 Score = 28.9 bits (63), Expect = 3.4 Identities = 8/14 (57%), Positives = 12/14 (85%) Frame = -1 Query: 302 CFSCGESGHFSREC 261 C+ CGESGH +++C Sbjct: 54 CYRCGESGHLAKDC 67 Score = 28.1 bits (61), Expect = 5.8 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = -1 Query: 302 CFSCGESGHFSREC 261 C+SCGE GH ++C Sbjct: 119 CYSCGEFGHIQKDC 132 Score = 27.3 bits (59), Expect = 10.0 Identities = 7/14 (50%), Positives = 12/14 (85%) Frame = -1 Query: 302 CFSCGESGHFSREC 261 C++CG+ GH +R+C Sbjct: 98 CYNCGKPGHLARDC 111
>CNBP_MOUSE (P53996) Cellular nucleic acid-binding protein (CNBP) (Zinc finger| protein 9) Length = 178 Score = 33.9 bits (76), Expect = 0.11 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = -1 Query: 302 CFSCGESGHFSRECP 258 CF CG SGH++RECP Sbjct: 6 CFKCGRSGHWARECP 20 Score = 31.6 bits (70), Expect = 0.53 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = -1 Query: 302 CFSCGESGHFSRECPNKA 249 C+ CGESGH +REC +A Sbjct: 159 CYRCGESGHLARECTIEA 176 Score = 28.9 bits (63), Expect = 3.4 Identities = 8/14 (57%), Positives = 12/14 (85%) Frame = -1 Query: 302 CFSCGESGHFSREC 261 C+ CGESGH +++C Sbjct: 54 CYRCGESGHLAKDC 67 Score = 28.1 bits (61), Expect = 5.8 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = -1 Query: 302 CFSCGESGHFSREC 261 C+SCGE GH ++C Sbjct: 120 CYSCGEFGHIQKDC 133 Score = 27.3 bits (59), Expect = 10.0 Identities = 7/14 (50%), Positives = 12/14 (85%) Frame = -1 Query: 302 CFSCGESGHFSREC 261 C++CG+ GH +R+C Sbjct: 99 CYNCGKPGHLARDC 112
>ZCHC5_HUMAN (Q8N8U3) Zinc finger CCHC domain-containing protein 5| Length = 475 Score = 33.9 bits (76), Expect = 0.11 Identities = 13/23 (56%), Positives = 15/23 (65%) Frame = -1 Query: 302 CFSCGESGHFSRECPNKAH*AAQ 234 C CG GHF+R+CP K H A Q Sbjct: 445 CLYCGYPGHFARDCPVKPHQALQ 467
>RBM4_RABIT (Q9BDY9) RNA-binding protein 4 (RNA-binding motif protein 4) (Lark| homolog) Length = 359 Score = 33.5 bits (75), Expect = 0.14 Identities = 10/16 (62%), Positives = 14/16 (87%) Frame = -1 Query: 305 GCFSCGESGHFSRECP 258 GC+ CG+ GH+S+ECP Sbjct: 161 GCYRCGKEGHWSKECP 176
>RBM4B_RAT (Q64LC9) RNA-binding protein 4B (RNA-binding motif protein 4B)| (RNA-binding protein 30) (RNA-binding motif protein 30) (Zinc-responsive protein ZD7) Length = 357 Score = 33.5 bits (75), Expect = 0.14 Identities = 10/16 (62%), Positives = 14/16 (87%) Frame = -1 Query: 305 GCFSCGESGHFSRECP 258 GC+ CG+ GH+S+ECP Sbjct: 161 GCYRCGKEGHWSKECP 176
>RBM4B_MOUSE (Q8VE92) RNA-binding protein 4B (RNA-binding motif protein 4B)| (RNA-binding protein 30) (RNA-binding motif protein 30) Length = 357 Score = 33.5 bits (75), Expect = 0.14 Identities = 10/16 (62%), Positives = 14/16 (87%) Frame = -1 Query: 305 GCFSCGESGHFSRECP 258 GC+ CG+ GH+S+ECP Sbjct: 161 GCYRCGKEGHWSKECP 176
>RBM4B_HUMAN (Q9BQ04) RNA-binding protein 4B (RNA-binding motif protein 4B)| (RNA-binding protein 30) (RNA-binding motif protein 30) Length = 359 Score = 33.5 bits (75), Expect = 0.14 Identities = 10/16 (62%), Positives = 14/16 (87%) Frame = -1 Query: 305 GCFSCGESGHFSRECP 258 GC+ CG+ GH+S+ECP Sbjct: 161 GCYRCGKEGHWSKECP 176
>RBM4_BOVIN (Q3MHX3) RNA-binding protein 4 (RNA-binding motif protein 4)| (RNA-binding motif protein 4a) Length = 362 Score = 33.5 bits (75), Expect = 0.14 Identities = 10/16 (62%), Positives = 14/16 (87%) Frame = -1 Query: 305 GCFSCGESGHFSRECP 258 GC+ CG+ GH+S+ECP Sbjct: 161 GCYRCGKEGHWSKECP 176
>RBM4_HUMAN (Q9BWF3) RNA-binding protein 4 (RNA-binding motif protein 4)| (RNA-binding motif protein 4a) (Lark homolog) (hLark) Length = 364 Score = 33.5 bits (75), Expect = 0.14 Identities = 10/16 (62%), Positives = 14/16 (87%) Frame = -1 Query: 305 GCFSCGESGHFSRECP 258 GC+ CG+ GH+S+ECP Sbjct: 161 GCYRCGKEGHWSKECP 176
>GAG_SRV1 (P04022) Gag polyprotein (Core polyprotein) [Contains: Core protein| p10; Core phosphoprotein pp18; Core protein p12; Core protein p27; Core protein p14; Core protein p4] Length = 657 Score = 33.5 bits (75), Expect = 0.14 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = -1 Query: 311 GGGCFSCGESGHFSRECPNKAH 246 GG CF CG GHF++ C H Sbjct: 546 GGCCFKCGRKGHFAKNCHEHIH 567
>RBM4_MOUSE (Q8C7Q4) RNA-binding protein 4 (RNA-binding motif protein 4)| (RNA-binding motif protein 4a) (Lark homolog) (mLark) Length = 361 Score = 33.5 bits (75), Expect = 0.14 Identities = 10/16 (62%), Positives = 14/16 (87%) Frame = -1 Query: 305 GCFSCGESGHFSRECP 258 GC+ CG+ GH+S+ECP Sbjct: 161 GCYRCGKEGHWSKECP 176
>GAG_BLVJ (P03344) Gag polyprotein [Contains: Core protein p15 (Matrix| protein); Core protein p24; Core protein p12] Length = 391 Score = 33.1 bits (74), Expect = 0.18 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = -1 Query: 308 GGCFSCGESGHFSRECPNKAH*AAQPVRSECPV 210 G C+ C + GH++R+CP K A P CP+ Sbjct: 344 GPCYRCLKEGHWARDCPTK---ATGPPPGPCPI 373
>CNBP_CHICK (O42395) Cellular nucleic acid-binding protein (CNBP) (Zinc finger| protein 9) Length = 172 Score = 32.7 bits (73), Expect = 0.24 Identities = 10/15 (66%), Positives = 13/15 (86%) Frame = -1 Query: 302 CFSCGESGHFSRECP 258 CF CG +GH++RECP Sbjct: 6 CFKCGRTGHWARECP 20 Score = 31.6 bits (70), Expect = 0.53 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = -1 Query: 302 CFSCGESGHFSRECPNKA 249 C+ CGESGH +REC +A Sbjct: 153 CYRCGESGHLARECTIEA 170 Score = 28.9 bits (63), Expect = 3.4 Identities = 8/14 (57%), Positives = 12/14 (85%) Frame = -1 Query: 302 CFSCGESGHFSREC 261 C+ CGESGH +++C Sbjct: 48 CYRCGESGHLAKDC 61 Score = 28.1 bits (61), Expect = 5.8 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = -1 Query: 302 CFSCGESGHFSREC 261 C+SCGE GH ++C Sbjct: 114 CYSCGEFGHIQKDC 127 Score = 27.3 bits (59), Expect = 10.0 Identities = 7/14 (50%), Positives = 12/14 (85%) Frame = -1 Query: 302 CFSCGESGHFSREC 261 C++CG+ GH +R+C Sbjct: 93 CYNCGKPGHLARDC 106
>GIS2_YEAST (P53849) Zinc-finger protein GIS2| Length = 153 Score = 32.3 bits (72), Expect = 0.31 Identities = 10/15 (66%), Positives = 13/15 (86%) Frame = -1 Query: 302 CFSCGESGHFSRECP 258 CF+C ++GH SRECP Sbjct: 67 CFNCNQTGHISRECP 81 Score = 31.6 bits (70), Expect = 0.53 Identities = 9/16 (56%), Positives = 14/16 (87%) Frame = -1 Query: 302 CFSCGESGHFSRECPN 255 C++CG++GH SR+C N Sbjct: 118 CYTCGQAGHMSRDCQN 133 Score = 30.0 bits (66), Expect = 1.5 Identities = 8/15 (53%), Positives = 13/15 (86%) Frame = -1 Query: 302 CFSCGESGHFSRECP 258 C++C E+GH S++CP Sbjct: 137 CYNCNETGHISKDCP 151 Score = 27.7 bits (60), Expect = 7.6 Identities = 13/38 (34%), Positives = 20/38 (52%), Gaps = 3/38 (7%) Frame = -1 Query: 302 CFSCGESGHFSRECP-NKAH*AAQP--VRSECPVPLRS 198 C++CGE+GH EC + Q + ECP P ++ Sbjct: 49 CYNCGETGHVRSECTVQRCFNCNQTGHISRECPEPKKT 86
>POLX_TOBAC (P10978) Retrovirus-related Pol polyprotein from transposon TNT| 1-94 [Includes: Protease (EC 3.4.23.-); Reverse transcriptase (EC 2.7.7.49); Endonuclease] Length = 1328 Score = 32.3 bits (72), Expect = 0.31 Identities = 9/16 (56%), Positives = 13/16 (81%) Frame = -1 Query: 302 CFSCGESGHFSRECPN 255 C++C + GHF R+CPN Sbjct: 232 CYNCNQPGHFKRDCPN 247
>ZCHC9_HUMAN (Q8N567) Zinc finger CCHC domain-containing protein 9| Length = 271 Score = 32.3 bits (72), Expect = 0.31 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = -1 Query: 302 CFSCGESGHFSRECPN 255 CF CGE GH SR CP+ Sbjct: 186 CFVCGEMGHLSRSCPD 201 Score = 28.1 bits (61), Expect = 5.8 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = -1 Query: 311 GGGCFSCGESGHFSRECP 258 GGGC CG H ++CP Sbjct: 210 GGGCKLCGSVEHLKKDCP 227
>ZCHC9_MOUSE (Q8R1J3) Zinc finger CCHC domain-containing protein 9| Length = 273 Score = 32.3 bits (72), Expect = 0.31 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = -1 Query: 302 CFSCGESGHFSRECPN 255 CF CGE GH SR CP+ Sbjct: 186 CFVCGEMGHLSRSCPD 201
>GAG_GALV (P21416) Gag polyprotein [Contains: Core protein p15; Core protein| p12; Core protein p30; Core protein p10] Length = 519 Score = 32.0 bits (71), Expect = 0.40 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = -1 Query: 302 CFSCGESGHFSRECPNKAH 246 C C E GH++RECP K H Sbjct: 490 CAYCKEKGHWARECPRKKH 508
>GAK6_HUMAN (P62685) HERV-K_8p23.1 provirus ancestral Gag polyprotein (Gag| polyprotein) (HERV-K115 Gag protein) [Contains: Matrix protein; Capsid protein; Nucleocapsid protein] Length = 646 Score = 31.6 bits (70), Expect = 0.53 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = -1 Query: 311 GGGCFSCGESGHFSRECP 258 GG C++CG+ GH + CP Sbjct: 542 GGKCYNCGQIGHLKKNCP 559
>GAK5_HUMAN (P62684) HERV-K_19p13.11 provirus ancestral Gag polyprotein (Gag| polyprotein) (HERV-K113 Gag protein) [Contains: Matrix protein; Capsid protein; Nucleocapsid protein] Length = 665 Score = 31.6 bits (70), Expect = 0.53 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = -1 Query: 311 GGGCFSCGESGHFSRECP 258 GG C++CG+ GH + CP Sbjct: 542 GGKCYNCGQIGHLKKNCP 559
>GAK4_HUMAN (P63126) HERV-K_6q14.1 provirus ancestral Gag polyprotein (Gag| polyprotein) (HERV-K109 Gag protein) (HERV-K(C6) Gag protein) [Contains: Matrix protein; Capsid protein; Nucleocapsid protein] Length = 665 Score = 31.6 bits (70), Expect = 0.53 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = -1 Query: 311 GGGCFSCGESGHFSRECP 258 GG C++CG+ GH + CP Sbjct: 542 GGKCYNCGQIGHLKKNCP 559
>GAK3_HUMAN (Q9YNA8) HERV-K_19q12 provirus ancestral Gag polyprotein (Gag| polyprotein) (HERV-K(C19) Gag protein) [Contains: Matrix protein; Capsid protein; Nucleocapsid protein] Length = 665 Score = 31.6 bits (70), Expect = 0.53 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = -1 Query: 311 GGGCFSCGESGHFSRECP 258 GG C++CG+ GH + CP Sbjct: 542 GGKCYNCGQIGHLKKNCP 559
>GAK1_HUMAN (P62683) HERV-K_12q14.1 provirus ancestral Gag polyprotein (Gag| polyprotein) [Contains: Matrix protein; Capsid protein; Nucleocapsid protein] Length = 665 Score = 31.6 bits (70), Expect = 0.53 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = -1 Query: 311 GGGCFSCGESGHFSRECP 258 GG C++CG+ GH + CP Sbjct: 542 GGKCYNCGQIGHLKKNCP 559
>GAK12_HUMAN (P63130) HERV-K_1q22 provirus ancestral Gag polyprotein (Gag| polyprotein) (HERV-K102 Gag protein) (HERV-K(III) Gag protein) [Contains: Matrix protein; Capsid protein; Nucleocapsid protein] Length = 665 Score = 31.6 bits (70), Expect = 0.53 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = -1 Query: 311 GGGCFSCGESGHFSRECP 258 GG C++CG+ GH + CP Sbjct: 542 GGKCYNCGQIGHLKKNCP 559
>GAK11_HUMAN (P63145) HERV-K_22q11.21 provirus ancestral Gag polyprotein (Gag| polyprotein) (HERV-K101 Gag protein) [Contains: Matrix protein; Capsid protein; Nucleocapsid protein] Length = 665 Score = 31.6 bits (70), Expect = 0.53 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = -1 Query: 311 GGGCFSCGESGHFSRECP 258 GG C++CG+ GH + CP Sbjct: 542 GGKCYNCGQIGHLKKNCP 559
>GAK10_HUMAN (P87889) HERV-K_5q33.3 provirus ancestral Gag polyprotein (Gag| polyprotein) (HERV-K10 Gag protein) (HERV-K107 Gag protein) [Contains: Matrix protein; Capsid protein; Nucleocapsid protein] Length = 665 Score = 31.6 bits (70), Expect = 0.53 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = -1 Query: 311 GGGCFSCGESGHFSRECP 258 GG C++CG+ GH + CP Sbjct: 542 GGKCYNCGQIGHLKKNCP 559
>ZCH11_HUMAN (Q5TAX3) Zinc finger CCHC domain-containing protein 11| Length = 1644 Score = 31.6 bits (70), Expect = 0.53 Identities = 16/35 (45%), Positives = 20/35 (57%), Gaps = 8/35 (22%) Frame = -1 Query: 302 CFSCGESGHFSRECP--------NKAH*AAQPVRS 222 CF CG++GH RECP N + AAQ VR+ Sbjct: 1359 CFICGDAGHVRRECPEVKLARQRNSSVAAAQLVRN 1393
>GAG_BLVAU (P25058) Gag polyprotein [Contains: Core protein p15 (Matrix| protein); Core protein p24; Core protein p12] Length = 391 Score = 31.6 bits (70), Expect = 0.53 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = -1 Query: 308 GGCFSCGESGHFSRECPNKAH*AAQPVRSECPV 210 G C+ C + GH++R+CP K P CP+ Sbjct: 344 GPCYRCLKEGHWARDCPTK---TTGPPPGPCPI 373
>COAT_SOCMV (P15627) Coat protein| Length = 441 Score = 31.2 bits (69), Expect = 0.69 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = -1 Query: 302 CFSCGESGHFSRECPNKAH*AAQPVR 225 C+ C E GH++ ECP K + AQ ++ Sbjct: 383 CWLCHEEGHYANECPKKDNKKAQTLK 408
>GLH4_CAEEL (O76743) ATP-dependent RNA helicase glh-4 (EC 3.6.1.-) (Germline| helicase 4) Length = 1156 Score = 31.2 bits (69), Expect = 0.69 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = -1 Query: 305 GCFSCGESGHFSREC 261 GC +CGE GH S+EC Sbjct: 571 GCHNCGEEGHISKEC 585 Score = 30.8 bits (68), Expect = 0.90 Identities = 9/19 (47%), Positives = 15/19 (78%) Frame = -1 Query: 308 GGCFSCGESGHFSRECPNK 252 G C +CG+ GHF+++C N+ Sbjct: 639 GPCRNCGQEGHFAKDCQNE 657
>GAG_HTL1M (P14077) Gag polyprotein [Contains: Major core protein p19; Major| core protein p24; Nucleic acid-binding protein p15] Length = 428 Score = 30.8 bits (68), Expect = 0.90 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = -1 Query: 302 CFSCGESGHFSRECPNKAH*AAQPVRSECPV 210 CF CG++GH+SR+C +P CP+ Sbjct: 356 CFRCGKAGHWSRDCTQ-----PRPPPGPCPL 381
>Y493_RICPR (Q9ZD54) Putative aldolase class 2 protein RP493| Length = 231 Score = 30.8 bits (68), Expect = 0.90 Identities = 23/85 (27%), Positives = 40/85 (47%) Frame = -1 Query: 305 GCFSCGESGHFSRECPNKAH*AAQPVRSECPVPLRSFSYRLTLQQVIHIPISISICRRSV 126 G +CG++ H E + Q +++C + T+QQ + IP S+ IC+++V Sbjct: 159 GAITCGKTIH---EAMFYTYHLEQACKTQCLL-------NSTIQQELIIP-SVEICKKTV 207 Query: 125 TPCFP*EEESTMRDWFQ*YCWWRVV 51 EE+ RDW W R++ Sbjct: 208 KDLLSFEEDLGKRDW---EAWLRLI 229
>GAG_HTL1C (P14076) Gag polyprotein [Contains: Major core protein p19; Major| core protein p24; Nucleic acid-binding protein p15] Length = 429 Score = 30.8 bits (68), Expect = 0.90 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = -1 Query: 302 CFSCGESGHFSRECPNKAH*AAQPVRSECPV 210 CF CG++GH+SR+C +P CP+ Sbjct: 357 CFRCGKAGHWSRDCTQ-----PRPPPGPCPL 382
>GAG_HTL1A (P03345) Gag polyprotein [Contains: Major core protein p19; Major| core protein p24; Nucleic acid-binding protein p15] Length = 429 Score = 30.8 bits (68), Expect = 0.90 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = -1 Query: 302 CFSCGESGHFSRECPNKAH*AAQPVRSECPV 210 CF CG++GH+SR+C +P CP+ Sbjct: 357 CFRCGKAGHWSRDCTQ-----PRPPPGPCPL 382
>GAK18_HUMAN (P62690) HERV-K_22q11.23 provirus ancestral Gag polyprotein (Gag| polyprotein) [Contains: Matrix protein; Capsid protein; Nucleocapsid protein] Length = 622 Score = 30.8 bits (68), Expect = 0.90 Identities = 13/33 (39%), Positives = 19/33 (57%), Gaps = 2/33 (6%) Frame = -1 Query: 311 GGGCFSCGESGHFSRECP--NKAH*AAQPVRSE 219 G C++CG+ GH R CP NK + Q + S+ Sbjct: 589 GKKCYNCGQIGHLKRSCPGLNKQNIINQAINSK 621
>GAG_RSVP (P03322) Gag polyprotein [Contains: Core protein p19; Core protein| p2A; Core protein p2B; Core protein p10; Capsid protein p27; Inner coat protein p12; Protease p15 (EC 3.4.23.-)] Length = 701 Score = 30.8 bits (68), Expect = 0.90 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = -1 Query: 308 GGCFSCGESGHFSRECPNK 252 G C++CG GH+ +CP K Sbjct: 507 GLCYTCGSPGHYQAQCPKK 525
>GAG_HV2SB (P12450) Gag polyprotein (Pr55Gag) [Contains: Matrix protein p17| (MA); Capsid protein p24 (CA); Spacer peptide p2; Nucleocapsid protein p7 (NC); Spacer peptide p1; p6] Length = 519 Score = 30.4 bits (67), Expect = 1.2 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = -1 Query: 305 GCFSCGESGHFSRECPNK 252 GC+ CG+SGH CP++ Sbjct: 409 GCWKCGKSGHIMANCPDR 426
>GAG_MMTVC (P11284) Gag polyprotein [Contains: Protein p10; Phosphorylated| protein pp21; Protein p3; Protein p8; Protein n; Major core protein p27; Nucleic acid-binding protein p14] Length = 590 Score = 30.4 bits (67), Expect = 1.2 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = -1 Query: 311 GGGCFSCGESGHFSREC 261 G CFSCG++GH R+C Sbjct: 523 GPVCFSCGKTGHIKRDC 539
>ZCHC4_XENLA (Q6DCD7) Zinc finger CCHC domain-containing protein 4| Length = 489 Score = 30.4 bits (67), Expect = 1.2 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = -1 Query: 311 GGGCFSCGESGHFSRECPN 255 G GCF CG GH R CP+ Sbjct: 428 GDGCFLCGGKGHKRRGCPH 446
>COAT_FMVD (P09519) Probable coat protein| Length = 489 Score = 30.4 bits (67), Expect = 1.2 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = -1 Query: 302 CFSCGESGHFSRECPNK 252 C+ C E GH++ ECPN+ Sbjct: 411 CWICTEEGHYANECPNR 427
>BYR3_SCHPO (P36627) Cellular nucleic acid-binding protein homolog| Length = 179 Score = 30.4 bits (67), Expect = 1.2 Identities = 10/17 (58%), Positives = 14/17 (82%) Frame = -1 Query: 311 GGGCFSCGESGHFSREC 261 G C++CGE+GH +REC Sbjct: 16 GPRCYNCGENGHQAREC 32 Score = 29.3 bits (64), Expect = 2.6 Identities = 8/16 (50%), Positives = 13/16 (81%) Frame = -1 Query: 302 CFSCGESGHFSRECPN 255 C++CG +GH R+CP+ Sbjct: 60 CYACGTAGHLVRDCPS 75 Score = 27.7 bits (60), Expect = 7.6 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = -1 Query: 311 GGGCFSCGESGHFSREC 261 G C+ CG GH +R+C Sbjct: 82 GAECYKCGRVGHIARDC 98
>POL_HV2SB (P12451) Gag-Pol polyprotein (Pr160Gag-Pol) [Contains: Matrix| protein p17 (MA); Capsid protein p24 (CA); p2 spacer peptide; Nucleocapsid protein* (NC*); Transframe peptide (TF) (p6 pol); Protease (EC 3.4.23.47) (Retropepsin) (PR); Reverse trans Length = 1461 Score = 30.4 bits (67), Expect = 1.2 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = -1 Query: 305 GCFSCGESGHFSRECPNK 252 GC+ CG+SGH CP++ Sbjct: 409 GCWKCGKSGHIMANCPDR 426
>GAG_HV2NZ (P05891) Gag polyprotein (Pr55Gag) [Contains: Matrix protein p17| (MA); Capsid protein p24 (CA); Spacer peptide p2; Nucleocapsid protein p7 (NC); Spacer peptide p1; p6] Length = 518 Score = 30.0 bits (66), Expect = 1.5 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = -1 Query: 305 GCFSCGESGHFSRECPNK 252 GC+ CG+SGH CP++ Sbjct: 408 GCWKCGKSGHVMANCPDR 425
>POL_HV2NZ (P05962) Gag-Pol polyprotein (Pr160Gag-Pol) [Contains: Matrix| protein p17 (MA); Capsid protein p24 (CA); p2 spacer peptide; Nucleocapsid protein* (NC*); Transframe peptide (TF) (p6 pol); Protease (EC 3.4.23.47) (Retropepsin) (PR); Reverse trans Length = 1460 Score = 30.0 bits (66), Expect = 1.5 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = -1 Query: 305 GCFSCGESGHFSRECPNK 252 GC+ CG+SGH CP++ Sbjct: 408 GCWKCGKSGHVMANCPDR 425
>POL_HV2D1 (P17757) Gag-Pol polyprotein (Pr160Gag-Pol) [Contains: Matrix| protein p17 (MA); Capsid protein p24 (CA); p2 spacer peptide; Nucleocapsid protein* (NC*); Transframe peptide (TF) (p6 pol); Protease (EC 3.4.23.47) (Retropepsin) (PR); Reverse trans Length = 1461 Score = 30.0 bits (66), Expect = 1.5 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -1 Query: 305 GCFSCGESGHFSRECPNK 252 GC+ CG+SGH CP + Sbjct: 410 GCWKCGKSGHIMANCPER 427
>GAG_JSRV (P31622) Gag polyprotein [Contains: Core protein p10; Core protein| p18; Core protein p12; Core protein p27; Core protein p14; Core protein p4] Length = 612 Score = 30.0 bits (66), Expect = 1.5 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = -1 Query: 305 GCFSCGESGHFSRECPNKAH*AAQPVRSECP 213 GCF CG+ GH + CP K H + + CP Sbjct: 508 GCFVCGQPGHRAAVCPQK-HQTSVNTPNLCP 537
>GAG_HV2D1 (P17756) Gag polyprotein (Pr55Gag) [Contains: Matrix protein p17| (MA); Capsid protein p24 (CA); Spacer peptide p2; Nucleocapsid protein p7 (NC); Spacer peptide p1; p6] Length = 520 Score = 30.0 bits (66), Expect = 1.5 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -1 Query: 305 GCFSCGESGHFSRECPNK 252 GC+ CG+SGH CP + Sbjct: 410 GCWKCGKSGHIMANCPER 427
>GAG_SIVVT (P05892) Gag polyprotein [Contains: Core protein p17; Core protein| p24; Core protein p15] Length = 519 Score = 29.6 bits (65), Expect = 2.0 Identities = 10/29 (34%), Positives = 18/29 (62%) Frame = -1 Query: 302 CFSCGESGHFSRECPNKAH*AAQPVRSEC 216 C++CG+ GH R+CP +P +++C Sbjct: 399 CYNCGKFGHMQRQCP-------EPRKTKC 420
>GAG_HTLV2 (P03346) Gag polyprotein [Contains: Core protein p15 (p19); Core| protein p24; Core protein p12 (p15)] Length = 432 Score = 29.6 bits (65), Expect = 2.0 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -1 Query: 302 CFSCGESGHFSRECPNKAH*AAQPVRSECPV 210 CF CG+ GH+SR+C +P CP+ Sbjct: 362 CFRCGKVGHWSRDCTQ-----PRPPPGPCPL 387
>ZCHC6_MOUSE (Q5BLK4) Zinc finger CCHC domain-containing protein 6| Length = 1491 Score = 29.6 bits (65), Expect = 2.0 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -1 Query: 302 CFSCGESGHFSRECP 258 CF CG GH +ECP Sbjct: 1449 CFICGREGHIKKECP 1463
>GAK8_HUMAN (Q9HDB9) HERV-K_3q12.3 provirus ancestral Gag polyprotein (Gag| polyprotein) (HERV-K(II) Gag protein) [Contains: Matrix protein; Capsid protein; Nucleocapsid protein] Length = 666 Score = 29.6 bits (65), Expect = 2.0 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -1 Query: 311 GGGCFSCGESGHFSRECP 258 G C++CG+ GH R CP Sbjct: 541 GKKCYNCGQIGHLKRSCP 558
>POL_HV2KR (Q74120) Gag-Pol polyprotein (Pr160Gag-Pol) [Contains: Matrix| protein p17 (MA); Capsid protein p24 (CA); p2 spacer peptide; Nucleocapsid protein* (NC*); Transframe peptide (TF) (p6 pol); Protease (EC 3.4.23.47) (Retropepsin) (PR); Reverse trans Length = 1462 Score = 29.6 bits (65), Expect = 2.0 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -1 Query: 305 GCFSCGESGHFSRECPNK 252 GC+ CG+SGH CP + Sbjct: 410 GCWKCGKSGHVMANCPER 427
>ZCHC6_HUMAN (Q5VYS8) Zinc finger CCHC domain-containing protein 6| Length = 1495 Score = 29.6 bits (65), Expect = 2.0 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -1 Query: 302 CFSCGESGHFSRECP 258 CF CG GH +ECP Sbjct: 1453 CFICGREGHIKKECP 1467
>GAG_HV2KR (Q74119) Gag polyprotein (Pr55Gag) [Contains: Matrix protein p17| (MA); Capsid protein p24 (CA); Spacer peptide p2; Nucleocapsid protein p7 (NC); Spacer peptide p1; p6] Length = 520 Score = 29.6 bits (65), Expect = 2.0 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -1 Query: 305 GCFSCGESGHFSRECPNK 252 GC+ CG+SGH CP + Sbjct: 410 GCWKCGKSGHVMANCPER 427
>POL_COYMV (P19199) Putative polyprotein [Contains: Coat protein; Protease (EC| 3.4.23.-); Reverse transcriptase (EC 2.7.7.49); Ribonuclease H (EC 3.1.26.4)] Length = 1886 Score = 29.6 bits (65), Expect = 2.0 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 302 CFSCGESGHFSRECPNK 252 C+ CG+ GH++ +C NK Sbjct: 881 CYICGQEGHYANQCRNK 897
>GAG_IPMA (P11365) Retrovirus-related Gag polyprotein [Contains: Protease (EC| 3.4.23.-)] Length = 827 Score = 29.3 bits (64), Expect = 2.6 Identities = 8/14 (57%), Positives = 12/14 (85%) Frame = -1 Query: 302 CFSCGESGHFSREC 261 CF+CG+ GHF ++C Sbjct: 460 CFNCGKPGHFKKDC 473
>GAG_MMTVB (P10258) Gag polyprotein [Contains: Protein p10; Phosphorylated| protein pp21; Protein p3; Protein p8; Protein n; Major core protein p27; Nucleic acid-binding protein p14] Length = 590 Score = 29.3 bits (64), Expect = 2.6 Identities = 9/20 (45%), Positives = 15/20 (75%) Frame = -1 Query: 311 GGGCFSCGESGHFSRECPNK 252 G CFSCG++GH ++C ++ Sbjct: 523 GPVCFSCGKTGHIRKDCKDE 542
>POL_HV2D2 (P15833) Gag-Pol polyprotein (Pr160Gag-Pol) [Contains: Matrix| protein p17 (MA); Capsid protein p24 (CA); p2 spacer peptide; Nucleocapsid protein* (NC*); Transframe peptide (TF) (p6 pol); Protease (EC 3.4.23.47) (Retropepsin) (PR); Reverse trans Length = 1464 Score = 29.3 bits (64), Expect = 2.6 Identities = 8/18 (44%), Positives = 13/18 (72%) Frame = -1 Query: 305 GCFSCGESGHFSRECPNK 252 GC+ CG++GH +CP + Sbjct: 409 GCWKCGKTGHIMSKCPER 426
>POL_HV2ST (P20876) Gag-Pol polyprotein (Pr160Gag-Pol) [Contains: Matrix| protein p17 (MA); Capsid protein p24 (CA); p2 spacer peptide; Nucleocapsid protein* (NC*); Transframe peptide (TF) (p6 pol); Protease (EC 3.4.23.47) (Retropepsin) (PR); Reverse trans Length = 1462 Score = 29.3 bits (64), Expect = 2.6 Identities = 8/18 (44%), Positives = 13/18 (72%) Frame = -1 Query: 305 GCFSCGESGHFSRECPNK 252 GC+ CG++GH +CP + Sbjct: 410 GCWKCGKAGHIMAKCPER 427
>GAG_SIVVG (P27978) Gag polyprotein [Contains: Core protein p17; Core protein| p24; Core protein p15] Length = 521 Score = 29.3 bits (64), Expect = 2.6 Identities = 8/15 (53%), Positives = 12/15 (80%) Frame = -1 Query: 302 CFSCGESGHFSRECP 258 C++CG+ GH R+CP Sbjct: 404 CYNCGKFGHMQRQCP 418
>TENX_HUMAN (P22105) Tenascin-X precursor (TN-X) (Hexabrachion-like protein)| Length = 4289 Score = 29.3 bits (64), Expect = 2.6 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = +3 Query: 138 TYTNTDRYMYDLLQSQAVGKGTKGNGALRSDGLR 239 TYT+ R++++ LQ Q +G G + DGLR Sbjct: 932 TYTSVARHIHEYLQRQVLGSSADGALLVSLDGLR 965
>GAG_SIVV1 (P27972) Gag polyprotein [Contains: Core protein p17; Core protein| p24; Core protein p15] Length = 520 Score = 29.3 bits (64), Expect = 2.6 Identities = 8/15 (53%), Positives = 12/15 (80%) Frame = -1 Query: 302 CFSCGESGHFSRECP 258 C++CG+ GH R+CP Sbjct: 400 CYNCGKFGHMQRQCP 414
>GAG_HV2ST (P20874) Gag polyprotein (Pr55Gag) [Contains: Matrix protein p17| (MA); Capsid protein p24 (CA); Spacer peptide p2; Nucleocapsid protein p7 (NC); Spacer peptide p1; p6] Length = 520 Score = 29.3 bits (64), Expect = 2.6 Identities = 8/18 (44%), Positives = 13/18 (72%) Frame = -1 Query: 305 GCFSCGESGHFSRECPNK 252 GC+ CG++GH +CP + Sbjct: 410 GCWKCGKAGHIMAKCPER 427
>GAG_HV2D2 (P15832) Gag polyprotein (Pr55Gag) [Contains: Matrix protein p17| (MA); Capsid protein p24 (CA); Spacer peptide p2; Nucleocapsid protein p7 (NC); Spacer peptide p1; p6] Length = 520 Score = 29.3 bits (64), Expect = 2.6 Identities = 8/18 (44%), Positives = 13/18 (72%) Frame = -1 Query: 305 GCFSCGESGHFSRECPNK 252 GC+ CG++GH +CP + Sbjct: 409 GCWKCGKTGHIMSKCPER 426
>GAG_EIAVY (P69732) Gag polyprotein [Contains: Matrix protein p15; Capsid| protein p26 (CA) (Major core protein p26); Nucleocapsid protein p11; p9] Length = 486 Score = 28.9 bits (63), Expect = 3.4 Identities = 15/49 (30%), Positives = 24/49 (48%), Gaps = 5/49 (10%) Frame = -1 Query: 302 CFSCGESGHFSREC---PNKAH*AAQ--PVRSECPVPLRSFSYRLTLQQ 171 CF C + GHFS++C P AQ P + P+ +S + +Q+ Sbjct: 402 CFKCKQPGHFSKQCRSVPKNGKQGAQGRPQKQTFPIQQKSQHNKSVVQE 450
>GAG_EIAVC (P69731) Gag polyprotein [Contains: Matrix protein p15; Capsid| protein p26 (CA) (Major core protein p26); Nucleocapsid protein p11; p9] Length = 486 Score = 28.9 bits (63), Expect = 3.4 Identities = 15/49 (30%), Positives = 24/49 (48%), Gaps = 5/49 (10%) Frame = -1 Query: 302 CFSCGESGHFSREC---PNKAH*AAQ--PVRSECPVPLRSFSYRLTLQQ 171 CF C + GHFS++C P AQ P + P+ +S + +Q+ Sbjct: 402 CFKCKQPGHFSKQCRSVPKNGKQGAQGRPQKQTFPIQQKSQHNKSVVQE 450
>GAG_EIAV9 (P69730) Gag polyprotein [Contains: Matrix protein p15; Capsid| protein p26 (CA) (Major core protein p26); Nucleocapsid protein p11; p9] Length = 486 Score = 28.9 bits (63), Expect = 3.4 Identities = 15/49 (30%), Positives = 24/49 (48%), Gaps = 5/49 (10%) Frame = -1 Query: 302 CFSCGESGHFSREC---PNKAH*AAQ--PVRSECPVPLRSFSYRLTLQQ 171 CF C + GHFS++C P AQ P + P+ +S + +Q+ Sbjct: 402 CFKCKQPGHFSKQCRSVPKNGKQGAQGRPQKQTFPIQQKSQHNKSVVQE 450
>POL_HV2G1 (P18042) Gag-Pol polyprotein (Pr160Gag-Pol) [Contains: Matrix| protein p17 (MA); Capsid protein p24 (CA); p2 spacer peptide; Nucleocapsid protein* (NC*); Transframe peptide (TF) (p6 pol); Protease (EC 3.4.23.47) (Retropepsin) (PR); Reverse trans Length = 1463 Score = 28.9 bits (63), Expect = 3.4 Identities = 8/18 (44%), Positives = 13/18 (72%) Frame = -1 Query: 305 GCFSCGESGHFSRECPNK 252 GC+ CG++GH +CP + Sbjct: 411 GCWKCGKTGHVMAKCPER 428
>GAG_SIVSP (P19504) Gag polyprotein [Contains: Core protein p17; Core protein| p24] Length = 507 Score = 28.9 bits (63), Expect = 3.4 Identities = 8/18 (44%), Positives = 13/18 (72%) Frame = -1 Query: 305 GCFSCGESGHFSRECPNK 252 GC+ CG++GH +CP + Sbjct: 414 GCWKCGKAGHVMAKCPER 431
>GAG_SIVS4 (P12496) Gag polyprotein [Contains: Core protein p17; Core protein| p24] Length = 507 Score = 28.9 bits (63), Expect = 3.4 Identities = 8/18 (44%), Positives = 13/18 (72%) Frame = -1 Query: 305 GCFSCGESGHFSRECPNK 252 GC+ CG++GH +CP + Sbjct: 414 GCWKCGKTGHVMAKCPER 431
>GAG_HV2G1 (P18041) Gag polyprotein (Pr55Gag) [Contains: Matrix protein p17| (MA); Capsid protein p24 (CA); Spacer peptide p2; Nucleocapsid protein p7 (NC); Spacer peptide p1; p6] Length = 521 Score = 28.9 bits (63), Expect = 3.4 Identities = 8/18 (44%), Positives = 13/18 (72%) Frame = -1 Query: 305 GCFSCGESGHFSRECPNK 252 GC+ CG++GH +CP + Sbjct: 411 GCWKCGKTGHVMAKCPER 428
>GAG_SIVG1 (Q02843) Gag polyprotein [Contains: Core protein p17; Core protein| p24; Core protein p15] Length = 513 Score = 28.9 bits (63), Expect = 3.4 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = -1 Query: 302 CFSCGESGHFSREC 261 CF+CG+ GH REC Sbjct: 392 CFNCGKFGHMQREC 405 Score = 28.5 bits (62), Expect = 4.5 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = -1 Query: 302 CFSCGESGHFSRECPN 255 CF CG+ GH +++C N Sbjct: 413 CFKCGKIGHMAKDCKN 428
>GAK2_HUMAN (Q7LDI9) HERV-K_7p22.1 provirus ancestral Gag polyprotein (Gag| polyprotein) (HERV-K(HML-2.HOM) Gag protein) (HERV-K108 Gag protein) (HERV-K(C7) Gag protein) [Contains: Matrix protein; Capsid protein; Nucleocapsid protein] Length = 665 Score = 28.5 bits (62), Expect = 4.5 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = -1 Query: 311 GGGCFSCGESGHFSRECP 258 G C++CG+ GH + CP Sbjct: 542 GRKCYNCGQIGHLKKNCP 559
>RBBP6_MOUSE (P97868) Retinoblastoma-binding protein 6 (p53-associated cellular| protein of testis) (Proliferation potential-related protein) (Protein P2P-R) Length = 1790 Score = 28.5 bits (62), Expect = 4.5 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -1 Query: 302 CFSCGESGHFSRECP 258 CF CG+ GH+ + CP Sbjct: 162 CFRCGKPGHYIKNCP 176
>POL_HV2RO (P04584) Gag-Pol polyprotein (Pr160Gag-Pol) [Contains: Matrix| protein p17 (MA); Capsid protein p24 (CA); p2 spacer peptide; Nucleocapsid protein* (NC*); Transframe peptide (TF) (p6 pol); Protease (EC 3.4.23.47) (Retropepsin) (PR); Reverse trans Length = 1463 Score = 28.5 bits (62), Expect = 4.5 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = -1 Query: 305 GCFSCGESGHFSRECPNK 252 GC+ CG+ GH CP++ Sbjct: 410 GCWKCGKPGHIMTNCPDR 427
>ZCH13_HUMAN (Q8WW36) Zinc finger CCHC domain-containing protein 13| Length = 166 Score = 28.5 bits (62), Expect = 4.5 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 311 GGGCFSCGESGHFSREC 261 G C++CG SGH +++C Sbjct: 64 GNICYNCGRSGHIAKDC 80 Score = 28.1 bits (61), Expect = 5.8 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = -1 Query: 299 FSCGESGHFSRECP 258 F+CG SGH++R CP Sbjct: 7 FACGHSGHWARGCP 20
>ZCHC7_HUMAN (Q8N3Z6) Zinc finger CCHC domain-containing protein 7| Length = 542 Score = 28.5 bits (62), Expect = 4.5 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = -1 Query: 302 CFSCGESGHFSRECPNK 252 C+ C + GH+ ECP + Sbjct: 349 CYHCAQKGHYGHECPER 365
>ZCH10_HUMAN (Q8TBK6) Zinc finger CCHC domain-containing protein 10| Length = 192 Score = 28.5 bits (62), Expect = 4.5 Identities = 18/47 (38%), Positives = 23/47 (48%), Gaps = 1/47 (2%) Frame = -1 Query: 302 CFSCGESGHFSRECPNKAH*AAQPVR-SECPVPLRSFSYRLTLQQVI 165 C C E GH++ EC K +P R +E L+ RL LQQ I Sbjct: 45 CQKCLEFGHWTYECTGKRKYLHRPSRTAELKKALKEKENRLLLQQSI 91
>POL_HV2CA (P24107) Gag-Pol polyprotein (Pr160Gag-Pol) [Contains: Matrix| protein p17 (MA); Capsid protein p24 (CA); p2 spacer peptide; Nucleocapsid protein* (NC*); Transframe peptide (TF) (p6 pol); Protease (EC 3.4.23.47) (Retropepsin) (PR); Reverse trans Length = 1461 Score = 28.5 bits (62), Expect = 4.5 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = -1 Query: 305 GCFSCGESGHFSRECPNK 252 GC+ CG+ GH CP++ Sbjct: 410 GCWKCGKPGHIMTNCPDR 427
>MSL5_YEAST (Q12186) Branchpoint-bridging protein MSL5 (MUD synthesis lethal 5| protein) Length = 476 Score = 28.5 bits (62), Expect = 4.5 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = -1 Query: 302 CFSCGESGHFSREC 261 C CG++GHFSR+C Sbjct: 299 CKICGQTGHFSRDC 312
>RBBP6_HUMAN (Q7Z6E9) Retinoblastoma-binding protein 6 (p53-associated cellular| protein of testis) (Proliferation potential-related protein) (Protein P2P-R) (Retinoblastoma-binding Q protein 1) (Protein RBQ-1) Length = 1792 Score = 28.5 bits (62), Expect = 4.5 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -1 Query: 302 CFSCGESGHFSRECP 258 CF CG+ GH+ + CP Sbjct: 161 CFRCGKPGHYIKNCP 175
>GAG_HV2RO (P04590) Gag polyprotein (Pr55Gag) [Contains: Matrix protein p17| (MA); Capsid protein p24 (CA); Spacer peptide p2; Nucleocapsid protein p7 (NC); Spacer peptide p1; p6] Length = 521 Score = 28.5 bits (62), Expect = 4.5 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = -1 Query: 305 GCFSCGESGHFSRECPNK 252 GC+ CG+ GH CP++ Sbjct: 410 GCWKCGKPGHIMTNCPDR 427
>GAG_HV2CA (P24106) Gag polyprotein (Pr55Gag) [Contains: Matrix protein p17| (MA); Capsid protein p24 (CA); Spacer peptide p2; Nucleocapsid protein p7 (NC); Spacer peptide p1; p6] Length = 520 Score = 28.5 bits (62), Expect = 4.5 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = -1 Query: 305 GCFSCGESGHFSRECPNK 252 GC+ CG+ GH CP++ Sbjct: 410 GCWKCGKPGHIMTNCPDR 427
>GAG_MLVFP (P26805) Gag polyprotein (Core polyprotein) [Contains: Matrix| protein p15; RNA-binding phosphoprotein p12; Capsid protein p30; Nucleocapsid protein p10] Length = 537 Score = 28.1 bits (61), Expect = 5.8 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = -1 Query: 302 CFSCGESGHFSRECPNK 252 C C E GH++R+CP K Sbjct: 503 CAYCKEKGHWARDCPKK 519
>GAG_MLVFF (P26806) Gag polyprotein (Core polyprotein) [Contains: Matrix| protein p15; RNA-binding phosphoprotein p12; Capsid protein p30; Nucleocapsid protein p10] Length = 537 Score = 28.1 bits (61), Expect = 5.8 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = -1 Query: 302 CFSCGESGHFSRECPNK 252 C C E GH++R+CP K Sbjct: 503 CAYCKEKGHWARDCPKK 519
>GAG_HV1MA (P04594) Gag polyprotein (Pr55Gag) [Contains: Matrix protein p17| (MA); Capsid protein p24 (CA); Spacer peptide p2; Nucleocapsid protein p7 (NC); Spacer peptide p1; p6] Length = 504 Score = 28.1 bits (61), Expect = 5.8 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = -1 Query: 302 CFSCGESGHFSREC 261 CF+CG+ GH +R C Sbjct: 397 CFNCGKEGHLARNC 410
>COAT_CAMVN (Q00956) Coat protein| Length = 488 Score = 28.1 bits (61), Expect = 5.8 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -1 Query: 302 CFSCGESGHFSRECPNK 252 C+ C GH++ ECPN+ Sbjct: 412 CWICNIEGHYANECPNR 428
>COAT_CAMVC (P03543) Coat protein| Length = 488 Score = 28.1 bits (61), Expect = 5.8 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -1 Query: 302 CFSCGESGHFSRECPNK 252 C+ C GH++ ECPN+ Sbjct: 412 CWICNIEGHYANECPNR 428
>POL_HV1BR (P03367) Gag-Pol polyprotein (Pr160Gag-Pol) [Contains: Matrix| protein p17 (MA); Capsid protein p24 (CA); p2 spacer peptide; Nucleocapsid protein* (NC*); Transframe peptide (TF) (p6 pol); Protease (EC 3.4.23.16) (Retropepsin) (PR); Reverse trans Length = 1446 Score = 28.1 bits (61), Expect = 5.8 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = -1 Query: 302 CFSCGESGHFSREC 261 CF+CG+ GH +R C Sbjct: 391 CFNCGKEGHIARNC 404
>POL_HV1B5 (P04587) Gag-Pol polyprotein (Pr160Gag-Pol) [Contains: Matrix| protein p17 (MA); Capsid protein p24 (CA); p2 spacer peptide; Nucleocapsid protein* (NC*); Transframe peptide (TF) (p6 pol); Protease (EC 3.4.23.16) (Retropepsin) (PR); Reverse trans Length = 1446 Score = 28.1 bits (61), Expect = 5.8 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = -1 Query: 302 CFSCGESGHFSREC 261 CF+CG+ GH +R C Sbjct: 391 CFNCGKEGHIARNC 404
>COAT_CERV (P05399) Probable coat protein| Length = 494 Score = 28.1 bits (61), Expect = 5.8 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -1 Query: 302 CFSCGESGHFSRECPNK 252 C+ C GH++ ECPN+ Sbjct: 420 CWVCNIEGHYANECPNR 436
>POL_HV1RH (P05959) Gag-Pol polyprotein (Pr160Gag-Pol) [Contains: Matrix| protein p17 (MA); Capsid protein p24 (CA); p2 spacer peptide; Nucleocapsid protein* (NC*); Transframe peptide (TF) (p6 pol); Protease (EC 3.4.23.16) (Retropepsin) (PR); Reverse trans Length = 1435 Score = 28.1 bits (61), Expect = 5.8 Identities = 8/18 (44%), Positives = 13/18 (72%) Frame = -1 Query: 305 GCFSCGESGHFSRECPNK 252 GC+ CG+ GH ++C N+ Sbjct: 411 GCWKCGKEGHQMKDCTNE 428
>POL_HV1JR (P20875) Gag-Pol polyprotein (Pr160Gag-Pol) [Contains: Matrix| protein p17 (MA); Capsid protein p24 (CA); p2 spacer peptide; Nucleocapsid protein* (NC*); Transframe peptide (TF) (p6 pol); Protease (EC 3.4.23.16) (Retropepsin) (PR); Reverse trans Length = 1438 Score = 28.1 bits (61), Expect = 5.8 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = -1 Query: 302 CFSCGESGHFSREC 261 CF+CG+ GH +R C Sbjct: 391 CFNCGKEGHIARNC 404 Score = 27.3 bits (59), Expect = 10.0 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = -1 Query: 305 GCFSCGESGHFSRECPNK 252 GC+ CG+ GH +EC + Sbjct: 411 GCWKCGKEGHQMKECTER 428
>GAG_HV1RH (P05890) Gag polyprotein (Pr55Gag) [Contains: Matrix protein p17| (MA); Capsid protein p24 (CA); Spacer peptide p2; Nucleocapsid protein p7 (NC); Spacer peptide p1; p6] Length = 500 Score = 28.1 bits (61), Expect = 5.8 Identities = 8/18 (44%), Positives = 13/18 (72%) Frame = -1 Query: 305 GCFSCGESGHFSRECPNK 252 GC+ CG+ GH ++C N+ Sbjct: 411 GCWKCGKEGHQMKDCTNE 428
>POL_HV1C4 (P05960) Gag-Pol polyprotein (Pr160Gag-Pol) [Contains: Matrix| protein p17 (MA); Capsid protein p24 (CA); p2 spacer peptide; Nucleocapsid protein* (NC*); Transframe peptide (TF) (p6 pol); Protease (EC 3.4.23.16) (Retropepsin) (PR)] (Fragment) Length = 549 Score = 28.1 bits (61), Expect = 5.8 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = -1 Query: 302 CFSCGESGHFSREC 261 CF+CG+ GH +R C Sbjct: 391 CFNCGKEGHIARNC 404
>ZCHC2_HUMAN (Q9C0B9) Zinc finger CCHC domain-containing protein 2 (Fragment)| Length = 899 Score = 28.1 bits (61), Expect = 5.8 Identities = 9/23 (39%), Positives = 16/23 (69%) Frame = -1 Query: 302 CFSCGESGHFSRECPNKAH*AAQ 234 C++CG SGH++++C + A Q Sbjct: 854 CYNCGVSGHYAQDCKQSSMEANQ 876
>POL_HV1J3 (P12498) Gag-Pol polyprotein (Pr160Gag-Pol) [Contains: Matrix| protein p17 (MA); Capsid protein p24 (CA); p2 spacer peptide; Nucleocapsid protein* (NC*); Transframe peptide (TF) (p6 pol); Protease (EC 3.4.23.16) (Retropepsin) (PR)] (Fragment) Length = 531 Score = 28.1 bits (61), Expect = 5.8 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = -1 Query: 302 CFSCGESGHFSREC 261 CF+CG+ GH +R C Sbjct: 391 CFNCGKEGHLARNC 404
>COAT_CAMVS (P03542) Coat protein| Length = 489 Score = 28.1 bits (61), Expect = 5.8 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -1 Query: 302 CFSCGESGHFSRECPNK 252 C+ C GH++ ECPN+ Sbjct: 414 CWICNIEGHYANECPNR 430
>COAT_CAMVD (P03544) Coat protein| Length = 490 Score = 28.1 bits (61), Expect = 5.8 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -1 Query: 302 CFSCGESGHFSRECPNK 252 C+ C GH++ ECPN+ Sbjct: 413 CWICNIEGHYANECPNR 429
>POL_HV1MA (P04588) Gag-Pol polyprotein (Pr160Gag-Pol) [Contains: Matrix| protein p17 (MA); Capsid protein p24 (CA); p2 spacer peptide; Nucleocapsid protein* (NC*); Transframe peptide (TF) (p6 pol); Protease (EC 3.4.23.16) (Retropepsin) (PR); Reverse trans Length = 1439 Score = 28.1 bits (61), Expect = 5.8 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = -1 Query: 302 CFSCGESGHFSREC 261 CF+CG+ GH +R C Sbjct: 397 CFNCGKEGHLARNC 410
>GAG_HV1BR (P03348) Gag polyprotein (Pr55Gag) [Contains: Matrix protein p17| (MA); Capsid protein p24 (CA); Spacer peptide p2; Nucleocapsid protein p7 (NC); Spacer peptide p1; p6] Length = 511 Score = 28.1 bits (61), Expect = 5.8 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = -1 Query: 302 CFSCGESGHFSREC 261 CF+CG+ GH +R C Sbjct: 391 CFNCGKEGHIARNC 404
>GAG_HV1B5 (P04593) Gag polyprotein (Pr55Gag) [Contains: Matrix protein p17| (MA); Capsid protein p24 (CA); Spacer peptide p2; Nucleocapsid protein p7 (NC); Spacer peptide p1; p6] Length = 511 Score = 28.1 bits (61), Expect = 5.8 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = -1 Query: 302 CFSCGESGHFSREC 261 CF+CG+ GH +R C Sbjct: 391 CFNCGKEGHIARNC 404
>ZCHC4_XENTR (Q66IH9) Zinc finger CCHC domain-containing protein 4| Length = 487 Score = 28.1 bits (61), Expect = 5.8 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = -1 Query: 311 GGGCFSCGESGHFSRECPNKA 249 G GCF CG H R CP+++ Sbjct: 428 GRGCFLCGGKDHKRRGCPHQS 448
>GAG_HV1LW (Q70622) Gag polyprotein (Pr55Gag) [Contains: Matrix protein p17| (MA); Capsid protein p24 (CA); Spacer peptide p2; Nucleocapsid protein p7 (NC); Spacer peptide p1; p6] Length = 499 Score = 28.1 bits (61), Expect = 5.8 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = -1 Query: 302 CFSCGESGHFSREC 261 CF+CG+ GH +R C Sbjct: 391 CFNCGKEGHIARNC 404
>GAG_HV1J3 (P12494) Gag polyprotein (Pr55Gag) [Contains: Matrix protein p17| (MA); Capsid protein p24 (CA); Spacer peptide p2; Nucleocapsid protein p7 (NC); Spacer peptide p1; p6] Length = 499 Score = 28.1 bits (61), Expect = 5.8 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = -1 Query: 302 CFSCGESGHFSREC 261 CF+CG+ GH +R C Sbjct: 391 CFNCGKEGHLARNC 404
>GAG_HV1C4 (P05887) Gag polyprotein (Pr55Gag) [Contains: Matrix protein p17| (MA); Capsid protein p24 (CA); Spacer peptide p2; Nucleocapsid protein p7 (NC); Spacer peptide p1; p6] Length = 499 Score = 28.1 bits (61), Expect = 5.8 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = -1 Query: 302 CFSCGESGHFSREC 261 CF+CG+ GH +R C Sbjct: 391 CFNCGKEGHIARNC 404
>ZCHC2_MOUSE (Q69ZB8) Zinc finger CCHC domain-containing protein 2 (Fragment)| Length = 1168 Score = 28.1 bits (61), Expect = 5.8 Identities = 9/23 (39%), Positives = 16/23 (69%) Frame = -1 Query: 302 CFSCGESGHFSRECPNKAH*AAQ 234 C++CG SGH++++C + A Q Sbjct: 1123 CYNCGVSGHYAQDCKQSSMEANQ 1145
>POL_HV2BE (P18096) Gag-Pol polyprotein (Pr160Gag-Pol) [Contains: Matrix| protein p17 (MA); Capsid protein p24 (CA); p2 spacer peptide; Nucleocapsid protein* (NC*); Transframe peptide (TF) (p6 pol); Protease (EC 3.4.23.47) (Retropepsin) (PR); Reverse trans Length = 1549 Score = 28.1 bits (61), Expect = 5.8 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -1 Query: 305 GCFSCGESGHFSRECPNK 252 GC+ CG+ GH CP + Sbjct: 410 GCWKCGKPGHIMANCPER 427
>GAG_SIVCZ (P17282) Gag polyprotein [Contains: Core protein p18; Core protein| p25; Core protein p16] Length = 508 Score = 28.1 bits (61), Expect = 5.8 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = -1 Query: 302 CFSCGESGHFSREC 261 CF+CG+ GH +R C Sbjct: 402 CFNCGKEGHLARNC 415
>GAG_HV2BE (P18095) Gag polyprotein (Pr55Gag) [Contains: Matrix protein p17| (MA); Capsid protein p24 (CA); Spacer peptide p2; Nucleocapsid protein p7 (NC); Spacer peptide p1; p6] Length = 520 Score = 28.1 bits (61), Expect = 5.8 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -1 Query: 305 GCFSCGESGHFSRECPNK 252 GC+ CG+ GH CP + Sbjct: 410 GCWKCGKPGHIMANCPER 427
>GAG_HV1JR (P20873) Gag polyprotein (Pr55Gag) [Contains: Matrix protein p17| (MA); Capsid protein p24 (CA); Spacer peptide p2; Nucleocapsid protein p7 (NC); Spacer peptide p1; p6] Length = 503 Score = 28.1 bits (61), Expect = 5.8 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = -1 Query: 302 CFSCGESGHFSREC 261 CF+CG+ GH +R C Sbjct: 391 CFNCGKEGHIARNC 404 Score = 27.3 bits (59), Expect = 10.0 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = -1 Query: 305 GCFSCGESGHFSRECPNK 252 GC+ CG+ GH +EC + Sbjct: 411 GCWKCGKEGHQMKECTER 428
>ZCHC4_HUMAN (Q9H5U6) Zinc finger CCHC domain-containing protein 4| Length = 513 Score = 28.1 bits (61), Expect = 5.8 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = -1 Query: 305 GCFSCGESGHFSRECPNKA 249 GCF CGE H CPN A Sbjct: 444 GCFICGELDHKRSTCPNIA 462
>GAG_MLVF5 (P26807) Gag polyprotein (Core polyprotein) [Contains: Matrix| protein p15; RNA-binding phosphoprotein p12; Capsid protein p30; Nucleocapsid protein p10] Length = 538 Score = 28.1 bits (61), Expect = 5.8 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = -1 Query: 302 CFSCGESGHFSRECPNK 252 C C E GH++R+CP K Sbjct: 504 CAYCKEKGHWARDCPKK 520
>CPSF4_MOUSE (Q8BQZ5) Cleavage and polyadenylation specificity factor, 30 kDa| subunit (CPSF 30 kDa subunit) (Clipper homolog) (Clipper/CPSF 30K) Length = 211 Score = 27.7 bits (60), Expect = 7.6 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -1 Query: 302 CFSCGESGHFSRECPNKAH 246 C+ CGE GH++ C K H Sbjct: 187 CYKCGEKGHYANRC-TKGH 204
>YL52_CAEEL (P34431) Hypothetical protein F44E2.2 in chromosome III| Length = 2186 Score = 27.7 bits (60), Expect = 7.6 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = -1 Query: 302 CFSCGESGHFSRECPNK 252 CF C E GH + CP K Sbjct: 591 CFRCNEMGHIAWNCPKK 607
>PHC2_MOUSE (Q9QWH1) Polyhomeotic-like protein 2 (mPH2) (Early development| regulatory protein 2) (p36) Length = 850 Score = 27.7 bits (60), Expect = 7.6 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +2 Query: 41 TSNKQHATSNTTGTNLASSILLPRGSTG 124 TSN+ T+NT+GTN +S + G G Sbjct: 10 TSNRASVTTNTSGTNSSSGCISSSGGGG 37
>CPSF4_HUMAN (O95639) Cleavage and polyadenylation specificity factor, 30 kDa| subunit (CPSF 30 kDa subunit) (NS1 effector domain-binding protein 1) (Neb-1) (No arches homolog) Length = 269 Score = 27.7 bits (60), Expect = 7.6 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -1 Query: 302 CFSCGESGHFSRECPNKAH 246 C+ CGE GH++ C K H Sbjct: 245 CYKCGEKGHYANRC-TKGH 262
>GAG_SIVM1 (P05894) Gag polyprotein [Contains: Core protein p17; Core protein| p24] Length = 506 Score = 27.7 bits (60), Expect = 7.6 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = -1 Query: 305 GCFSCGESGHFSRECPNK 252 GC+ CG+ H +CPN+ Sbjct: 413 GCWKCGKMDHVMAKCPNR 430
>POST_XENLA (P27536) Posterior protein (xPO)| Length = 555 Score = 27.3 bits (59), Expect = 10.0 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = -1 Query: 302 CFSCGESGHFSRECPNKAH 246 C+SCG+ GH +R C A+ Sbjct: 415 CYSCGKYGHIARFCRTSAN 433
>POL_HV1PV (P03368) Gag-Pol polyprotein (Pr160Gag-Pol) [Contains: Matrix| protein p17 (MA); Capsid protein p24 (CA); p2 spacer peptide; Nucleocapsid protein* (NC*); Transframe peptide (TF) (p6 pol); Protease (EC 3.4.23.16) (Retropepsin) (PR); Reverse trans Length = 1446 Score = 27.3 bits (59), Expect = 10.0 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = -1 Query: 302 CFSCGESGHFSREC 261 CF+CG+ GH +R C Sbjct: 391 CFNCGKEGHTARNC 404
>POL_HV1B1 (P03366) Gag-Pol polyprotein (Pr160Gag-Pol) [Contains: Matrix| protein p17 (MA); Capsid protein p24 (CA); p2 spacer peptide; Nucleocapsid protein* (NC*); Transframe peptide (TF) (p6 pol); Protease (EC 3.4.23.16) (Retropepsin) (PR); Reverse trans Length = 1446 Score = 27.3 bits (59), Expect = 10.0 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = -1 Query: 302 CFSCGESGHFSREC 261 CF+CG+ GH +R C Sbjct: 391 CFNCGKEGHTARNC 404
>GAG_VILVK (P35955) Gag polyprotein [Contains: Core protein p16; Core protein| p25; Core protein p14] Length = 442 Score = 27.3 bits (59), Expect = 10.0 Identities = 7/14 (50%), Positives = 12/14 (85%) Frame = -1 Query: 302 CFSCGESGHFSREC 261 C++CG+ GH +R+C Sbjct: 387 CYNCGKPGHLARQC 400
>GAG_VILV2 (P23425) Gag polyprotein [Contains: Core protein p16; Core protein| p25; Core protein p14] Length = 442 Score = 27.3 bits (59), Expect = 10.0 Identities = 7/14 (50%), Positives = 12/14 (85%) Frame = -1 Query: 302 CFSCGESGHFSREC 261 C++CG+ GH +R+C Sbjct: 387 CYNCGKPGHLARQC 400
>GAG_VILV1 (P23424) Gag polyprotein [Contains: Core protein p16; Core protein| p25; Core protein p14] Length = 442 Score = 27.3 bits (59), Expect = 10.0 Identities = 7/14 (50%), Positives = 12/14 (85%) Frame = -1 Query: 302 CFSCGESGHFSREC 261 C++CG+ GH +R+C Sbjct: 387 CYNCGKPGHLARQC 400
>GAG_VILV (P03352) Gag polyprotein [Contains: Core protein p16; Core protein| p25; Core protein p14] Length = 442 Score = 27.3 bits (59), Expect = 10.0 Identities = 7/14 (50%), Positives = 12/14 (85%) Frame = -1 Query: 302 CFSCGESGHFSREC 261 C++CG+ GH +R+C Sbjct: 387 CYNCGKPGHLARQC 400
>AIR1_YEAST (P40507) Protein AIR1 (Arginine methyltransferase-interacting RING| finger protein 1) Length = 360 Score = 27.3 bits (59), Expect = 10.0 Identities = 7/17 (41%), Positives = 12/17 (70%) Frame = -1 Query: 302 CFSCGESGHFSRECPNK 252 C++CG +GHF +C + Sbjct: 175 CYNCGNAGHFGDDCAER 191
>AIR2_YEAST (Q12476) Protein AIR2 (Arginine methyltransferase-interacting RING| finger protein 2) Length = 344 Score = 27.3 bits (59), Expect = 10.0 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = -1 Query: 302 CFSCGESGHFSRECPNK 252 C++CG GHF +C K Sbjct: 164 CYNCGGKGHFGDDCKEK 180
>SFRS7_HUMAN (Q16629) Splicing factor, arginine/serine-rich 7 (Splicing factor| 9G8) Length = 238 Score = 27.3 bits (59), Expect = 10.0 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = -1 Query: 302 CFSCGESGHFSREC 261 C+ CGE GH++ +C Sbjct: 106 CYECGEKGHYAYDC 119
>PEP7_YEAST (P32609) Vacuolar segregation protein PEP7 (Protein VAC1) (Vacuolar| protein sorting 19) Length = 515 Score = 27.3 bits (59), Expect = 10.0 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = -1 Query: 197 FSYRLTLQQVIHIPISISICRRSVTPCF 114 F Y + ++HIPISI +C + F Sbjct: 270 FEYNIQKDDLLHIPISIRLCSHCIDMLF 297
>GAG_HV1PV (P03350) Gag polyprotein (Pr55Gag) [Contains: Matrix protein p17| (MA); Capsid protein p24 (CA); Spacer peptide p2; Nucleocapsid protein p7 (NC); Spacer peptide p1; p6] Length = 511 Score = 27.3 bits (59), Expect = 10.0 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = -1 Query: 302 CFSCGESGHFSREC 261 CF+CG+ GH +R C Sbjct: 391 CFNCGKEGHTARNC 404
>GAG_HV1B1 (P03347) Gag polyprotein (Pr55Gag) [Contains: Matrix protein p17| (MA); Capsid protein p24 (CA); Spacer peptide p2; Nucleocapsid protein p7 (NC); Spacer peptide p1; p6] Length = 511 Score = 27.3 bits (59), Expect = 10.0 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = -1 Query: 302 CFSCGESGHFSREC 261 CF+CG+ GH +R C Sbjct: 391 CFNCGKEGHTARNC 404
>GAG_SIVMS (P31634) Gag polyprotein [Contains: Core protein p17; Core protein| p24] Length = 510 Score = 27.3 bits (59), Expect = 10.0 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = -1 Query: 305 GCFSCGESGHFSRECPNK 252 GC+ CG+ GH +CP + Sbjct: 413 GCWKCGKPGHQMAKCPER 430
>GAG_BIV27 (P19559) Gag polyprotein (p53) [Contains: Matrix protein p17;| Capsid protein p26; Nucleocapsid protein p14] Length = 476 Score = 27.3 bits (59), Expect = 10.0 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = -1 Query: 311 GGGCFSCGESGHFSREC 261 G C+ CG++GH R C Sbjct: 402 GRRCYGCGKTGHLKRNC 418
>GAG_BIV06 (P19558) Gag polyprotein (p53) [Contains: Matrix protein p17;| Capsid protein p26; Nucleocapsid protein p14] Length = 476 Score = 27.3 bits (59), Expect = 10.0 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = -1 Query: 311 GGGCFSCGESGHFSREC 261 G C+ CG++GH R C Sbjct: 402 GRRCYGCGKTGHLKRNC 418
>GAG_HV1H2 (P04591) Gag polyprotein (Pr55Gag) [Contains: Matrix protein p17| (MA); Capsid protein p24 (CA); Spacer peptide p2; Nucleocapsid protein p7 (NC); Spacer peptide p1; p6] Length = 499 Score = 27.3 bits (59), Expect = 10.0 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = -1 Query: 302 CFSCGESGHFSREC 261 CF+CG+ GH +R C Sbjct: 391 CFNCGKEGHTARNC 404
>YLE5_CAEEL (P46941) Hypothetical protein C38D4.5 in chromosome III| Length = 837 Score = 27.3 bits (59), Expect = 10.0 Identities = 12/35 (34%), Positives = 23/35 (65%) Frame = +2 Query: 35 KITSNKQHATSNTTGTNLASSILLPRGSTG*HYGD 139 +I S ++S+++ TN++++ LPR S G +Y D Sbjct: 30 EIMSESAESSSSSSQTNVSAANTLPRESNGQNYAD 64
>SFRS7_MOUSE (Q8BL97) Splicing factor, arginine/serine-rich 7| Length = 267 Score = 27.3 bits (59), Expect = 10.0 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = -1 Query: 302 CFSCGESGHFSREC 261 C+ CGE GH++ +C Sbjct: 135 CYECGEKGHYAYDC 148
>POL_HV1H2 (P04585) Gag-Pol polyprotein (Pr160Gag-Pol) [Contains: Matrix| protein p17 (MA); Capsid protein p24 (CA); p2 spacer peptide; Nucleocapsid protein* (NC*); Transframe peptide (TF) (p6 pol); Protease (EC 3.4.23.16) (Retropepsin) (PR); Reverse trans Length = 1434 Score = 27.3 bits (59), Expect = 10.0 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = -1 Query: 302 CFSCGESGHFSREC 261 CF+CG+ GH +R C Sbjct: 391 CFNCGKEGHTARNC 404 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 38,552,879 Number of Sequences: 219361 Number of extensions: 660967 Number of successful extensions: 1806 Number of sequences better than 10.0: 149 Number of HSP's better than 10.0 without gapping: 1614 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1805 length of database: 80,573,946 effective HSP length: 79 effective length of database: 63,244,427 effective search space used: 1517866248 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)