| Clone Name | rbasd15h16 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | SOS1_MOUSE (Q62245) Son of sevenless homolog 1 (SOS-1) (mSOS-1) | 29 | 3.9 | 2 | SOS1_HUMAN (Q07889) Son of sevenless homolog 1 (SOS-1) | 29 | 3.9 | 3 | SRC64_DROME (P00528) Tyrosine-protein kinase Src64B (EC 2.7.10.2... | 28 | 8.6 | 4 | YCR6_YEAST (P25353) Hypothetical protein YCR026C | 28 | 8.6 |
|---|
>SOS1_MOUSE (Q62245) Son of sevenless homolog 1 (SOS-1) (mSOS-1)| Length = 1319 Score = 28.9 bits (63), Expect = 3.9 Identities = 15/44 (34%), Positives = 21/44 (47%) Frame = -1 Query: 138 LSQIPRNFSFSDLTEDFSHSTEILENYGRSPFIPSETNNFSEST 7 L Q PR S+S + E + ST N R+P P + S +T Sbjct: 1056 LQQEPRKISYSRIPESETESTASAPNSPRTPLTPPPASGTSSNT 1099
>SOS1_HUMAN (Q07889) Son of sevenless homolog 1 (SOS-1)| Length = 1333 Score = 28.9 bits (63), Expect = 3.9 Identities = 15/44 (34%), Positives = 21/44 (47%) Frame = -1 Query: 138 LSQIPRNFSFSDLTEDFSHSTEILENYGRSPFIPSETNNFSEST 7 L Q PR S+S + E + ST N R+P P + S +T Sbjct: 1056 LQQEPRKISYSRIPESETESTASAPNSPRTPLTPPPASGASSTT 1099
>SRC64_DROME (P00528) Tyrosine-protein kinase Src64B (EC 2.7.10.2) (Dsrc64)| Length = 552 Score = 27.7 bits (60), Expect = 8.6 Identities = 15/47 (31%), Positives = 24/47 (51%) Frame = -1 Query: 159 DTSSYGFLSQIPRNFSFSDLTEDFSHSTEILENYGRSPFIPSETNNF 19 D SYG L + F++ + HS E++EN R +P TN++ Sbjct: 462 DVWSYGIL--LMELFTYGQVPYPGMHSREVIENIERGFRMPKPTNHY 506
>YCR6_YEAST (P25353) Hypothetical protein YCR026C| Length = 742 Score = 27.7 bits (60), Expect = 8.6 Identities = 19/72 (26%), Positives = 30/72 (41%), Gaps = 17/72 (23%) Frame = -1 Query: 201 ELNGQPLGDPILDMDTSSY--GFLSQIPRNFSFSDLTEDF---------------SHSTE 73 + NGQP+ ++D + S+ GF S++P F L HST Sbjct: 84 DANGQPIDTELVDENELSFGTGFHSKVPFKIIFRTLFGSLVFAIFLILMINIAKPHHSTR 143 Query: 72 ILENYGRSPFIP 37 +L ++G F P Sbjct: 144 VLSHFGSPEFDP 155 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 26,454,447 Number of Sequences: 219361 Number of extensions: 373152 Number of successful extensions: 977 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 970 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 977 length of database: 80,573,946 effective HSP length: 42 effective length of database: 71,360,784 effective search space used: 1712658816 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)