| Clone Name | rbasd15h15 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | Y200_MYCPN (Q50288) Hypothetical lipoprotein MPN200 precursor (G... | 30 | 6.9 |
|---|
>Y200_MYCPN (Q50288) Hypothetical lipoprotein MPN200 precursor (GT9_orf798)| Length = 798 Score = 30.0 bits (66), Expect = 6.9 Identities = 24/85 (28%), Positives = 39/85 (45%), Gaps = 3/85 (3%) Frame = -3 Query: 664 GGSFSSSELNGQPLGDPILDMDTSSYGFLSQIPRNFSFSD---LTEDFSHSTEILENYGR 494 GGS+SS+ L I +Y F Q + F F+D E S++TE+ Sbjct: 391 GGSYSSNFQKFHQLAYSISSTSGFAYSFAGQNSKRFKFTDDGTFVEYPSYTTEV-----N 445 Query: 493 SPFIPXETNNFSESTAGGHTEIGNI 419 +P E+NN ++ G ++ GN+ Sbjct: 446 AP----ESNNGNDGKQQGQSDQGNL 466 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 95,780,368 Number of Sequences: 219361 Number of extensions: 1841532 Number of successful extensions: 4169 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 4022 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4167 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6825954960 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)