| Clone Name | rbasd15g05 |
|---|---|
| Clone Library Name | barley_pub |
>LONH1_MAIZE (P93647) Lon protease homolog 1, mitochondrial precursor (EC| 3.4.21.-) Length = 885 Score = 52.0 bits (123), Expect = 1e-06 Identities = 26/38 (68%), Positives = 29/38 (76%) Frame = -3 Query: 591 EIPAPILAGIEILLVKRIEEVLGHAFENGFPLRLHSSL 478 E+P PIL+ +EILLVKRIEEVL HAFE PLR S L Sbjct: 848 EVPLPILSDMEILLVKRIEEVLDHAFEGRCPLRSRSKL 885
>LONH1_ARATH (O64948) Lon protease homolog 1, mitochondrial precursor (EC| 3.4.21.-) Length = 888 Score = 41.6 bits (96), Expect = 0.002 Identities = 17/33 (51%), Positives = 26/33 (78%) Frame = -3 Query: 591 EIPAPILAGIEILLVKRIEEVLGHAFENGFPLR 493 E+PA +L+ +E++L KR+E+VL +AFE G P R Sbjct: 850 EVPAAVLSSLEVILAKRMEDVLENAFEGGCPWR 882
>DEF2_COXBU (Q83AK6) Peptide deformylase 2 (EC 3.5.1.88) (PDF 2) (Polypeptide| deformylase 2) Length = 209 Score = 32.7 bits (73), Expect = 0.81 Identities = 13/44 (29%), Positives = 24/44 (54%) Frame = -2 Query: 211 IEGCSSIYARFGIGSKEIHLLLSVWVYM*PISAREN*MLQYHKK 80 IEGC S+ + G+ + +H+ L+ W+Y A +YH++ Sbjct: 98 IEGCLSVPGKVGVVERYVHVELTAWLYHSDTEALSKIKREYHRE 141
>LON_ERWAM (P46067) ATP-dependent protease La (EC 3.4.21.53)| Length = 784 Score = 30.8 bits (68), Expect = 3.1 Identities = 15/28 (53%), Positives = 20/28 (71%) Frame = -3 Query: 591 EIPAPILAGIEILLVKRIEEVLGHAFEN 508 EIP ++A ++I VKRIEEVL A +N Sbjct: 746 EIPENVIADLDIHPVKRIEEVLALALQN 773
>SYGA_RICPR (Q9ZCB0) Glycyl-tRNA synthetase alpha chain (EC 6.1.1.14)| (Glycine--tRNA ligase alpha chain) (GlyRS) Length = 289 Score = 30.0 bits (66), Expect = 5.3 Identities = 20/56 (35%), Positives = 25/56 (44%), Gaps = 2/56 (3%) Frame = +2 Query: 50 AMMITCAIDT--FFMILQHSILPG*NRLHIHPNRQQQVDLLATNTKPSIDR*ASLY 211 A ++ C D F +Q S PG +R +HPNR Q KPS D LY Sbjct: 40 ATVLRCLGDKPWFIAYVQPSRRPGDSRYGMHPNRMQHYYQFQVILKPSPDNIQDLY 95
>LON_BUCAP (Q8K988) ATP-dependent protease La (EC 3.4.21.53)| Length = 777 Score = 30.0 bits (66), Expect = 5.3 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = -3 Query: 591 EIPAPILAGIEILLVKRIEEVLGHAFEN 508 EIP I+ G+ I VK IEEVL A EN Sbjct: 746 EIPKNIIEGLTIYPVKNIEEVLKIALEN 773
>LON_ECOLI (P0A9M0) ATP-dependent protease La (EC 3.4.21.53)| Length = 784 Score = 29.6 bits (65), Expect = 6.9 Identities = 15/28 (53%), Positives = 20/28 (71%) Frame = -3 Query: 591 EIPAPILAGIEILLVKRIEEVLGHAFEN 508 EIP ++A ++I VKRIEEVL A +N Sbjct: 746 EIPDNVIADLDIHPVKRIEEVLTLALQN 773
>LON_ECOL6 (P0A9M1) ATP-dependent protease La (EC 3.4.21.53)| Length = 784 Score = 29.6 bits (65), Expect = 6.9 Identities = 15/28 (53%), Positives = 20/28 (71%) Frame = -3 Query: 591 EIPAPILAGIEILLVKRIEEVLGHAFEN 508 EIP ++A ++I VKRIEEVL A +N Sbjct: 746 EIPDNVIADLDIHPVKRIEEVLTLALQN 773
>MOEA_HAEIN (P45210) Molybdopterin biosynthesis protein moeA| Length = 404 Score = 29.3 bits (64), Expect = 9.0 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = +2 Query: 491 SLKGNPFSKAWPSTSSMRFTSRISMP 568 S GNPF + WPS S++R + +P Sbjct: 74 SFAGNPFQEEWPSKSAVRIMTGAMIP 99 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 86,060,403 Number of Sequences: 219361 Number of extensions: 1794253 Number of successful extensions: 4222 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 4092 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4222 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 5216272880 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)