| Clone Name | rbasd15f13 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | SCFD2_HUMAN (Q8WU76) Sec1 family domain-containing protein 2 (Sy... | 29 | 3.1 | 2 | SCFD2_MOUSE (Q8BTY8) Sec1 family domain-containing protein 2 (Sy... | 28 | 5.3 |
|---|
>SCFD2_HUMAN (Q8WU76) Sec1 family domain-containing protein 2 (Syntaxin-binding| protein 1-like 1) Length = 684 Score = 29.3 bits (64), Expect = 3.1 Identities = 13/32 (40%), Positives = 20/32 (62%) Frame = -2 Query: 152 SKPNFGDQSFLIVFVVGGINTLEVREVMKAIS 57 S+P+ D LI+FVVGG+ EV+ V ++ Sbjct: 616 SRPHPSDYPLLILFVVGGVTVSEVKMVKDLVA 647
>SCFD2_MOUSE (Q8BTY8) Sec1 family domain-containing protein 2 (Syntaxin-binding| protein 1-like 1) (Neuronal Sec1) Length = 684 Score = 28.5 bits (62), Expect = 5.3 Identities = 12/32 (37%), Positives = 19/32 (59%) Frame = -2 Query: 152 SKPNFGDQSFLIVFVVGGINTLEVREVMKAIS 57 S+P+ D LI+FVVGG+ E + V ++ Sbjct: 616 SRPHPSDHPLLILFVVGGVTVAEAKMVKDLVA 647 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 23,144,883 Number of Sequences: 219361 Number of extensions: 309006 Number of successful extensions: 755 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 752 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 755 length of database: 80,573,946 effective HSP length: 28 effective length of database: 74,431,838 effective search space used: 1786364112 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)