| Clone Name | rbasd14p06 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | SSK2_YEAST (P53599) MAP kinase kinase kinase SSK2 (EC 2.7.11.25)... | 32 | 1.4 | 2 | YGFA_ECOLI (P0AC28) Hypothetical protein ygfA | 30 | 5.4 | 3 | YGFA_ECO57 (P0AC29) Hypothetical protein ygfA | 30 | 5.4 | 4 | TLR9_FELCA (Q5I2M7) Toll-like receptor 9 precursor (CD289 antigen) | 29 | 9.2 |
|---|
>SSK2_YEAST (P53599) MAP kinase kinase kinase SSK2 (EC 2.7.11.25) (Suppressor of| sensor kinase 2) Length = 1579 Score = 32.0 bits (71), Expect = 1.4 Identities = 14/37 (37%), Positives = 22/37 (59%) Frame = -3 Query: 507 VAVDPSTGGTTKGRVRDLQSWNMGCFVIWEL*MIRPW 397 +A + TG TTKG++ W++GC V+ + RPW Sbjct: 1464 MAPESITGSTTKGKLGADDVWSLGCVVLEMITGRRPW 1500
>YGFA_ECOLI (P0AC28) Hypothetical protein ygfA| Length = 182 Score = 30.0 bits (66), Expect = 5.4 Identities = 15/37 (40%), Positives = 23/37 (62%) Frame = -2 Query: 403 TMVVTTVHDKQLVDDIPVEKLLIHDVPVDIICTPTQV 293 T V HD QLV+ +PVE+ D+P+ + TP++V Sbjct: 146 TQPVGYAHDCQLVEKLPVEE---WDIPLPAVVTPSKV 179
>YGFA_ECO57 (P0AC29) Hypothetical protein ygfA| Length = 182 Score = 30.0 bits (66), Expect = 5.4 Identities = 15/37 (40%), Positives = 23/37 (62%) Frame = -2 Query: 403 TMVVTTVHDKQLVDDIPVEKLLIHDVPVDIICTPTQV 293 T V HD QLV+ +PVE+ D+P+ + TP++V Sbjct: 146 TQPVGYAHDCQLVEKLPVEE---WDIPLPAVVTPSKV 179
>TLR9_FELCA (Q5I2M7) Toll-like receptor 9 precursor (CD289 antigen)| Length = 1031 Score = 29.3 bits (64), Expect = 9.2 Identities = 17/47 (36%), Positives = 21/47 (44%) Frame = +1 Query: 337 LAAFQLECHPLIACHVQLLLPWSNHL*LPYNEASHIPALQIPHPSLS 477 L+ CH I H L +P L L YN + +PAL SLS Sbjct: 103 LSPMHFPCHMTIEPHTFLAVPTLEELNLSYNSITTVPALPSSLVSLS 149 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 85,062,584 Number of Sequences: 219361 Number of extensions: 1682640 Number of successful extensions: 3927 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 3802 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3926 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5310515667 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)