| Clone Name | rbasd14o16 |
|---|---|
| Clone Library Name | barley_pub |
>SCYBG_MOUSE (Q8BSU2) Small inducible cytokine B16 precursor (Transmembrane| chemokine CXCL16) (SR-PSOX) (Scavenger receptor for phosphatidylserine and oxidized low density lipoprotein) Length = 246 Score = 30.0 bits (66), Expect = 6.7 Identities = 17/64 (26%), Positives = 29/64 (45%), Gaps = 1/64 (1%) Frame = +1 Query: 292 PTPTIVHVRSILDLTN-CPSYLLYLFDSPSFCLSRVFQWHVSVLFPIT*KK*ATGSGTRY 468 P T+ H+R L + CP ++ + S S C QW ++ K+ TG G + Sbjct: 48 PQGTLDHIRKYLKAFHRCPFFIRFQLQSKSVCGGSQDQWVRELVDCFERKECGTGHGKSF 107 Query: 469 YHYR 480 +H + Sbjct: 108 HHQK 111
>RBBP6_MOUSE (P97868) Retinoblastoma-binding protein 6 (p53-associated cellular| protein of testis) (Proliferation potential-related protein) (Protein P2P-R) Length = 1790 Score = 30.0 bits (66), Expect = 6.7 Identities = 14/38 (36%), Positives = 18/38 (47%) Frame = -3 Query: 192 RNVAKGRKIHGPTPLSPPRRNYEITPRTPSASRGHGPT 79 R+ ++ H SPP R Y R+P A RG PT Sbjct: 746 RSRSRSHGYHRSRSRSPPYRRYHSRSRSPQAFRGQSPT 783
>RLUE_XANCP (Q8PDR2) Ribosomal large subunit pseudouridine synthase E (EC| 5.4.99.-) (rRNA-uridine isomerase E) (rRNA pseudouridylate synthase E) Length = 187 Score = 29.6 bits (65), Expect = 8.8 Identities = 14/36 (38%), Positives = 20/36 (55%) Frame = +2 Query: 422 SPLLRKSEPPVQVQDTIITAWTIRQPTRNRNDPIAR 529 +P L +PPV+V+ T+ AW Q T RN + R Sbjct: 110 APTLWPRDPPVRVRKTVPDAWLEVQITEGRNRQVRR 145
>RLUE_XANAC (Q8PQN3) Ribosomal large subunit pseudouridine synthase E (EC| 5.4.99.-) (rRNA-uridine isomerase E) (rRNA pseudouridylate synthase E) Length = 190 Score = 29.6 bits (65), Expect = 8.8 Identities = 14/36 (38%), Positives = 20/36 (55%) Frame = +2 Query: 422 SPLLRKSEPPVQVQDTIITAWTIRQPTRNRNDPIAR 529 +P L +PPV+V+ T+ AW Q T RN + R Sbjct: 110 APQLWPRDPPVRVRKTVPDAWLELQITEGRNRQVRR 145
>FLNC_MOUSE (Q8VHX6) Filamin-C (Gamma-filamin) (Filamin-2) (FLN-C)| (Actin-binding-like protein) (ABP-L) (ABP-280-like protein) (Fragment) Length = 1144 Score = 29.6 bits (65), Expect = 8.8 Identities = 25/79 (31%), Positives = 35/79 (44%), Gaps = 1/79 (1%) Frame = -1 Query: 251 EDQVGPCE*LDA-LSPFNPLSEM*QKEGKSMDRPHCLHPVGTTRSPQGRLRRPGVTDRP* 75 E+ V P E L++ L PFN + ++G+ G R P G+ RP +TD Sbjct: 188 EEPVVPVEPLESMLRPFNLVIPFTVQKGEL---------TGEVRMPSGKTARPNITD--- 235 Query: 74 TLFNKWNTLAVRSPVGSKG 18 NK T+ VR KG Sbjct: 236 ---NKDGTITVRYAPTEKG 251
>Y4142_BRAJA (Q89MQ0) UPF0061 protein bll4142| Length = 491 Score = 29.6 bits (65), Expect = 8.8 Identities = 17/46 (36%), Positives = 24/46 (52%), Gaps = 4/46 (8%) Frame = -1 Query: 311 WTIVG-VGGSPRLPSSGIPGEEDQVGPCE*LDALSP---FNPLSEM 186 W +VG + G +S I GE GPC +DA +P F+ + EM Sbjct: 237 WLLVGFIHGVMNTDNSSISGETIDYGPCAFMDAYNPAQVFSSIDEM 282 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 112,435,367 Number of Sequences: 219361 Number of extensions: 2608951 Number of successful extensions: 6941 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6594 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6941 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6655306086 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)