| Clone Name | rbasd14n21 |
|---|---|
| Clone Library Name | barley_pub |
>Y1511_PYRHO (O59180) Hypothetical protein PH1511| Length = 266 Score = 31.2 bits (69), Expect = 2.5 Identities = 18/60 (30%), Positives = 28/60 (46%), Gaps = 4/60 (6%) Frame = -1 Query: 388 VALPAGEEPNTSEQGRREEV----VTLYETPRHLYSKIRLGRSMVGEHYMPKYIRTMELL 221 V LPAG + + Q E +TL E R K+R ++ EH M +RT++ + Sbjct: 166 VELPAGMQKAMARQAEAERERRARITLAEAERQAAEKLREAAEIISEHPMALQLRTLQTI 225
>Y658_PYRAB (Q9V0Y1) Hypothetical protein PYRAB06580| Length = 268 Score = 31.2 bits (69), Expect = 2.5 Identities = 18/60 (30%), Positives = 29/60 (48%), Gaps = 4/60 (6%) Frame = -1 Query: 388 VALPAGEEPNTSEQGRREEV----VTLYETPRHLYSKIRLGRSMVGEHYMPKYIRTMELL 221 V LPAG + ++Q E +TL E R K+R ++ EH M +RT++ + Sbjct: 166 VELPAGMQRAMAKQAEAERERRARITLAEAERQAAEKLREAAEIISEHPMALQLRTLQTI 225
>YWJA_BACSU (P45861) Hypothetical ABC transporter ATP-binding protein ywjA| Length = 575 Score = 31.2 bits (69), Expect = 2.5 Identities = 17/41 (41%), Positives = 23/41 (56%) Frame = +3 Query: 360 LGSSPAGNATMCSILPGGYSWRESSEGLDGDSSICLTRPSL 482 +G S AG +T+CS+LP Y E +DG S +T SL Sbjct: 365 VGPSGAGKSTLCSLLPRFYEASEGDITIDGISIKDMTLSSL 405
>ARA_DROME (Q24248) Homeobox protein araucan| Length = 717 Score = 30.0 bits (66), Expect = 5.7 Identities = 18/45 (40%), Positives = 22/45 (48%) Frame = +1 Query: 253 CNVPLP*TSPDESCCRDVEVSRTG*QPPPAYLAHWCWVPLQLAMQ 387 C VP+P T P D +T PPPAY+ H +PLQ Q Sbjct: 456 CGVPIPATKPKIWSLADTVGCKT---PPPAYMGHQS-MPLQQQQQ 496
>MK_HUMAN (P21741) Midkine precursor (MK) (Neurite outgrowth-promoting| protein) (Midgestation and kidney protein) (Amphiregulin-associated protein) (ARAP) (Neurite outgrowth-promoting factor 2) Length = 143 Score = 29.3 bits (64), Expect = 9.7 Identities = 12/35 (34%), Positives = 16/35 (45%) Frame = +1 Query: 334 PPAYLAHWCWVPLQLAMQPCAVFFLEGIAGGNLQK 438 P + A W W P + + C V F EG G Q+ Sbjct: 33 PGSECAEWAWGPCTPSSKDCGVGFREGTCGAQTQR 67
>SAP3_MOUSE (Q60648) Ganglioside GM2 activator precursor (GM2-AP) (Cerebroside| sulfate activator protein) (Shingolipid activator protein 3) (SAP-3) Length = 193 Score = 29.3 bits (64), Expect = 9.7 Identities = 16/42 (38%), Positives = 21/42 (50%), Gaps = 6/42 (14%) Frame = +3 Query: 339 RLPCSLVLGSSPAGNATMCSILP------GGYSWRESSEGLD 446 RLP L+LG AG+ ++P GG+SW EG D Sbjct: 3 RLPLLLLLGLLLAGSVAPARLVPKRLSQLGGFSWDNCDEGKD 44
>MLO10_ARATH (Q9FKY5) MLO-like protein 10 (AtMlo10)| Length = 569 Score = 29.3 bits (64), Expect = 9.7 Identities = 14/37 (37%), Positives = 17/37 (45%) Frame = +1 Query: 355 WCWVPLQLAMQPCAVFFLEGIAGGNLQKGLTVTAPFA 465 WCW L Q F AGG +KGL+ T +A Sbjct: 7 WCWTTLLFCSQLLTGFARASSAGGAKEKGLSQTPTWA 43 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 87,386,595 Number of Sequences: 219361 Number of extensions: 1820250 Number of successful extensions: 4286 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 4162 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4285 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5596027262 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)