| Clone Name | rbasd14n12 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | MAK5_YEAST (P38112) ATP-dependent RNA helicase MAK5 (EC 3.6.1.-)... | 35 | 0.22 | 2 | Y3055_STRAW (Q82IS8) UPF0182 protein SAV3055 | 31 | 4.1 | 3 | RL13A_RAT (P35427) 60S ribosomal protein L13a | 30 | 7.0 | 4 | RL13A_MOUSE (P19253) 60S ribosomal protein L13a (Transplantation... | 30 | 7.0 |
|---|
>MAK5_YEAST (P38112) ATP-dependent RNA helicase MAK5 (EC 3.6.1.-) (Maintenance| of killer protein 5) Length = 773 Score = 35.0 bits (79), Expect = 0.22 Identities = 27/92 (29%), Positives = 39/92 (42%), Gaps = 1/92 (1%) Frame = -2 Query: 583 PSGTMLQPASAAAVCRLKRWNLLMATTFQSK*VLILFCPVRRLYAKLRKRAQVLKGGSFG 404 P T L P S + L+ N L T Q K + ++ V V+ S G Sbjct: 170 PEWTNLAPLSMTILQSLQNLNFLRPTEIQKKSIPVIMQGV-----------DVMGKASTG 218 Query: 403 SGTTIVYSLTEAEKLLLN-TMGNAEPVELNIT 311 SG T+ Y + EKL+ N + N +P+ L T Sbjct: 219 SGKTLAYGIPIVEKLISNFSQKNKKPISLIFT 250
>Y3055_STRAW (Q82IS8) UPF0182 protein SAV3055| Length = 998 Score = 30.8 bits (68), Expect = 4.1 Identities = 17/51 (33%), Positives = 28/51 (54%), Gaps = 1/51 (1%) Frame = -2 Query: 508 TTFQSK*VLILFCPVRRL-YAKLRKRAQVLKGGSFGSGTTIVYSLTEAEKL 359 T++Q K + L P+ R YA Q+L G+ G G+ I+Y+ T E++ Sbjct: 513 TSYQGKSGVNLSSPINRAAYAVAFSEPQILYSGAIGEGSRILYNRTPKERV 563
>RL13A_RAT (P35427) 60S ribosomal protein L13a| Length = 202 Score = 30.0 bits (66), Expect = 7.0 Identities = 21/75 (28%), Positives = 34/75 (45%), Gaps = 8/75 (10%) Frame = -1 Query: 608 APHKTMTRTVRHYAPAGQRRRRVPVEEMEFVDGYYLSIEVSADLVLP------RAKTVRQ 447 AP + RTVR P +R + +E ++ +DG + +V+P R K R+ Sbjct: 74 APSRIFWRTVRGMLPHKTKRGQAALERLKVLDGIPPPYDKKKRMVVPAALKVVRLKPTRK 133 Query: 446 VAQKGASAQ--GWEF 408 A G A GW++ Sbjct: 134 FAYLGRLAHEVGWKY 148
>RL13A_MOUSE (P19253) 60S ribosomal protein L13a (Transplantation antigen P198)| (Tum-P198 antigen) Length = 202 Score = 30.0 bits (66), Expect = 7.0 Identities = 21/75 (28%), Positives = 34/75 (45%), Gaps = 8/75 (10%) Frame = -1 Query: 608 APHKTMTRTVRHYAPAGQRRRRVPVEEMEFVDGYYLSIEVSADLVLP------RAKTVRQ 447 AP + RTVR P +R + +E ++ +DG + +V+P R K R+ Sbjct: 74 APSRIFWRTVRGMLPHKTKRGQAALERLKVLDGIPPPYDKKKRMVVPAALKVVRLKPTRK 133 Query: 446 VAQKGASAQ--GWEF 408 A G A GW++ Sbjct: 134 FAYLGRLAHEVGWKY 148 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 100,427,472 Number of Sequences: 219361 Number of extensions: 2071445 Number of successful extensions: 4890 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4747 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4879 length of database: 80,573,946 effective HSP length: 109 effective length of database: 56,663,597 effective search space used: 6912958834 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)