| Clone Name | rbasd15b09 |
|---|---|
| Clone Library Name | barley_pub |
>BRD3_MOUSE (Q8K2F0) Bromodomain-containing protein 3 (Bromodomain-containing| FSH-like protein FSRG2) Length = 726 Score = 36.2 bits (82), Expect = 0.020 Identities = 15/21 (71%), Positives = 18/21 (85%) Frame = -2 Query: 304 ELPDYNDAIEHPMDFNTVKRK 242 EL DY+D I+HPMD +TVKRK Sbjct: 343 ELHDYHDIIKHPMDLSTVKRK 363 Score = 30.0 bits (66), Expect = 1.4 Identities = 11/26 (42%), Positives = 18/26 (69%) Frame = -2 Query: 301 LPDYNDAIEHPMDFNTVKRKHARSAY 224 LPDY+ I++PMD T+K++ + Y Sbjct: 69 LPDYHKIIKNPMDMGTIKKRLENNYY 94
>BRD3_HUMAN (Q15059) Bromodomain-containing protein 3 (RING3-like protein)| Length = 726 Score = 36.2 bits (82), Expect = 0.020 Identities = 15/21 (71%), Positives = 18/21 (85%) Frame = -2 Query: 304 ELPDYNDAIEHPMDFNTVKRK 242 EL DY+D I+HPMD +TVKRK Sbjct: 344 ELHDYHDIIKHPMDLSTVKRK 364 Score = 30.0 bits (66), Expect = 1.4 Identities = 11/26 (42%), Positives = 18/26 (69%) Frame = -2 Query: 301 LPDYNDAIEHPMDFNTVKRKHARSAY 224 LPDY+ I++PMD T+K++ + Y Sbjct: 70 LPDYHKIIKNPMDMGTIKKRLENNYY 95
>BRD2_HUMAN (P25440) Bromodomain-containing protein 2 (RING3 protein) (O27.1.1)| Length = 801 Score = 34.7 bits (78), Expect = 0.058 Identities = 15/26 (57%), Positives = 18/26 (69%) Frame = -2 Query: 301 LPDYNDAIEHPMDFNTVKRKHARSAY 224 L DY+D I+HPMD +TVKRK Y Sbjct: 383 LHDYHDIIKHPMDLSTVKRKMENRDY 408 Score = 30.8 bits (68), Expect = 0.84 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = -2 Query: 301 LPDYNDAIEHPMDFNTVKRKHARSAY 224 LPDY+ I+ PMD T+KR+ + Y Sbjct: 110 LPDYHKIIKQPMDMGTIKRRLENNYY 135
>BRD2_CANFA (Q5TJG6) Bromodomain-containing protein 2| Length = 803 Score = 34.7 bits (78), Expect = 0.058 Identities = 15/26 (57%), Positives = 18/26 (69%) Frame = -2 Query: 301 LPDYNDAIEHPMDFNTVKRKHARSAY 224 L DY+D I+HPMD +TVKRK Y Sbjct: 383 LHDYHDIIKHPMDLSTVKRKMENRDY 408 Score = 30.8 bits (68), Expect = 0.84 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = -2 Query: 301 LPDYNDAIEHPMDFNTVKRKHARSAY 224 LPDY+ I+ PMD T+KR+ + Y Sbjct: 110 LPDYHKIIKQPMDMGTIKRRLENNYY 135
>BAZ1B_MOUSE (Q9Z277) Bromodomain adjacent to zinc finger domain protein 1B| (Williams-Beuren syndrome chromosome region 9 protein homolog) (WBRS9) Length = 1479 Score = 34.3 bits (77), Expect = 0.076 Identities = 17/42 (40%), Positives = 21/42 (50%), Gaps = 8/42 (19%) Frame = -2 Query: 316 F*WP--------ELPDYNDAIEHPMDFNTVKRKHARSAYHLI 215 F WP E DY D IEHPMDF T++ K + Y + Sbjct: 1356 FSWPFREPVTRDEAEDYYDVIEHPMDFQTIQNKCSCGNYRSV 1397
>BRD1_HUMAN (O95696) Bromodomain-containing protein 1 (BR140-like protein)| Length = 1058 Score = 33.9 bits (76), Expect = 0.099 Identities = 13/27 (48%), Positives = 19/27 (70%) Frame = -2 Query: 304 ELPDYNDAIEHPMDFNTVKRKHARSAY 224 E+PDY D I+HPMDF T++++ Y Sbjct: 595 EVPDYLDHIKHPMDFATMRKRLEAQGY 621
>BAZ1B_HUMAN (Q9UIG0) Bromodomain adjacent to zinc finger domain protein 1B| (Williams-Beuren syndrome chromosome region 9 protein) (WBRS9) (Williams syndrome transcription factor) (hWALP2) Length = 1483 Score = 33.5 bits (75), Expect = 0.13 Identities = 17/42 (40%), Positives = 21/42 (50%), Gaps = 8/42 (19%) Frame = -2 Query: 316 F*WP--------ELPDYNDAIEHPMDFNTVKRKHARSAYHLI 215 F WP E DY D I HPMDF TV+ K + +Y + Sbjct: 1360 FSWPFREPVTRDEAEDYYDVITHPMDFQTVQNKCSCGSYRSV 1401
>CBP_HUMAN (Q92793) CREB-binding protein (EC 2.3.1.48)| Length = 2442 Score = 32.0 bits (71), Expect = 0.38 Identities = 11/20 (55%), Positives = 17/20 (85%) Frame = -2 Query: 301 LPDYNDAIEHPMDFNTVKRK 242 +PDY D +++PMD +T+KRK Sbjct: 1122 IPDYFDIVKNPMDLSTIKRK 1141
>CBP_MOUSE (P45481) CREB-binding protein (EC 2.3.1.48)| Length = 2441 Score = 32.0 bits (71), Expect = 0.38 Identities = 11/20 (55%), Positives = 17/20 (85%) Frame = -2 Query: 301 LPDYNDAIEHPMDFNTVKRK 242 +PDY D +++PMD +T+KRK Sbjct: 1123 IPDYFDIVKNPMDLSTIKRK 1142
>BRPF3_HUMAN (Q9ULD4) Bromodomain and PHD finger-containing protein 3| Length = 1205 Score = 31.6 bits (70), Expect = 0.49 Identities = 13/30 (43%), Positives = 19/30 (63%) Frame = -2 Query: 304 ELPDYNDAIEHPMDFNTVKRKHARSAYHLI 215 E+PDY + I PMDF+T++RK Y + Sbjct: 622 EVPDYLEFISKPMDFSTMRRKLESHLYRTL 651
>EP300_HUMAN (Q09472) E1A-associated protein p300 (EC 2.3.1.48)| Length = 2414 Score = 31.2 bits (69), Expect = 0.64 Identities = 11/20 (55%), Positives = 16/20 (80%) Frame = -2 Query: 301 LPDYNDAIEHPMDFNTVKRK 242 +PDY D ++ PMD +T+KRK Sbjct: 1086 IPDYFDIVKSPMDLSTIKRK 1105
>GCN5_SCHPO (Q9UUK2) Histone acetyltransferase gcn5 (EC 2.3.1.48)| Length = 454 Score = 31.2 bits (69), Expect = 0.64 Identities = 11/30 (36%), Positives = 20/30 (66%) Frame = -2 Query: 304 ELPDYNDAIEHPMDFNTVKRKHARSAYHLI 215 ++PDY + IEHPMD +T++ + + Y + Sbjct: 376 DVPDYYEVIEHPMDLSTMEFRLRNNQYESV 405
>BRWD1_HUMAN (Q9NSI6) Bromodomain and WD-repeat domain-containing protein 1| (WD-repeat protein 9) Length = 2320 Score = 30.8 bits (68), Expect = 0.84 Identities = 12/19 (63%), Positives = 14/19 (73%) Frame = -2 Query: 304 ELPDYNDAIEHPMDFNTVK 248 E PDY D I+ PMDF TV+ Sbjct: 1346 EYPDYRDIIDTPMDFGTVR 1364
>BRWD1_MOUSE (Q921C3) Bromodomain and WD-repeat domain-containing protein 1| (WD-repeat protein 9) Length = 2304 Score = 30.8 bits (68), Expect = 0.84 Identities = 12/19 (63%), Positives = 14/19 (73%) Frame = -2 Query: 304 ELPDYNDAIEHPMDFNTVK 248 E PDY D I+ PMDF TV+ Sbjct: 1348 EYPDYRDIIDTPMDFGTVR 1366
>BRD7_PONPY (Q5R8B0) Bromodomain-containing protein 7| Length = 651 Score = 30.8 bits (68), Expect = 0.84 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = -2 Query: 298 PDYNDAIEHPMDFNTVKRKHARSAYHLI 215 P Y+ I+HPMDF+T+K K + Y I Sbjct: 166 PGYSMIIKHPMDFSTMKEKIKNNDYQSI 193
>BRD7_MOUSE (O88665) Bromodomain-containing protein 7 (75 kDa bromodomain| protein) Length = 651 Score = 30.8 bits (68), Expect = 0.84 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = -2 Query: 298 PDYNDAIEHPMDFNTVKRKHARSAYHLI 215 P Y+ I+HPMDF+T+K K + Y I Sbjct: 166 PGYSMIIKHPMDFSTMKEKIKNNDYQSI 193
>BRD7_HUMAN (Q9NPI1) Bromodomain-containing protein 7 (75 kDa bromodomain| protein) (Protein CELTIX-1) Length = 651 Score = 30.8 bits (68), Expect = 0.84 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = -2 Query: 298 PDYNDAIEHPMDFNTVKRKHARSAYHLI 215 P Y+ I+HPMDF+T+K K + Y I Sbjct: 166 PGYSMIIKHPMDFSTMKEKIKNNDYQSI 193
>FSH_DROME (P13709) Homeotic protein female sterile (Fragile-chorion membrane| protein) Length = 2038 Score = 30.8 bits (68), Expect = 0.84 Identities = 14/26 (53%), Positives = 16/26 (61%) Frame = -2 Query: 301 LPDYNDAIEHPMDFNTVKRKHARSAY 224 L DY+D I+ PMD TVKRK Y Sbjct: 514 LHDYHDIIKKPMDLGTVKRKMDNREY 539 Score = 29.6 bits (65), Expect = 1.9 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = -2 Query: 301 LPDYNDAIEHPMDFNTVKRKHARSAY 224 LPDY+ I+ PMD T+K++ + Y Sbjct: 70 LPDYHKIIKQPMDMGTIKKRLENNYY 95
>BRD4_HUMAN (O60885) Bromodomain-containing protein 4 (HUNK1 protein)| Length = 1362 Score = 30.0 bits (66), Expect = 1.4 Identities = 12/20 (60%), Positives = 15/20 (75%) Frame = -2 Query: 301 LPDYNDAIEHPMDFNTVKRK 242 L DY D I+HPMD +T+K K Sbjct: 387 LHDYCDIIKHPMDMSTIKSK 406 Score = 27.7 bits (60), Expect = 7.1 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = -2 Query: 301 LPDYNDAIEHPMDFNTVKRKHARSAY 224 LPDY I+ PMD T+K++ + Y Sbjct: 94 LPDYYKIIKTPMDMGTIKKRLENNYY 119
>BRD4_MOUSE (Q9ESU6) Bromodomain-containing protein 4 (Mitotic| chromosome-associated protein) (MCAP) Length = 1400 Score = 30.0 bits (66), Expect = 1.4 Identities = 12/20 (60%), Positives = 15/20 (75%) Frame = -2 Query: 301 LPDYNDAIEHPMDFNTVKRK 242 L DY D I+HPMD +T+K K Sbjct: 388 LHDYCDIIKHPMDMSTIKSK 407 Score = 27.7 bits (60), Expect = 7.1 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = -2 Query: 301 LPDYNDAIEHPMDFNTVKRKHARSAY 224 LPDY I+ PMD T+K++ + Y Sbjct: 94 LPDYYKIIKTPMDMGTIKKRLENNYY 119
>YCK2_SCHPO (Q9Y7N0) Hypothetical bromodomain protein C1450.02| Length = 578 Score = 29.6 bits (65), Expect = 1.9 Identities = 11/27 (40%), Positives = 18/27 (66%) Frame = -2 Query: 304 ELPDYNDAIEHPMDFNTVKRKHARSAY 224 + PDY D I+ PMD +T++ K ++ Y Sbjct: 289 DCPDYFDVIKEPMDLSTIQSKLNKNEY 315
>BRPF1_HUMAN (P55201) Peregrin (Bromodomain and PHD finger-containing protein 1)| (BR140 protein) Length = 1214 Score = 29.3 bits (64), Expect = 2.4 Identities = 12/20 (60%), Positives = 16/20 (80%) Frame = -2 Query: 304 ELPDYNDAIEHPMDFNTVKR 245 E+PDY D I+ PMDF T+K+ Sbjct: 661 EVPDYLDHIKKPMDFFTMKQ 680
>GCN5_YARLI (Q8WZM0) Histone acetyltransferase GCN5 (EC 2.3.1.48)| Length = 464 Score = 28.9 bits (63), Expect = 3.2 Identities = 10/27 (37%), Positives = 19/27 (70%) Frame = -2 Query: 304 ELPDYNDAIEHPMDFNTVKRKHARSAY 224 E+PDY + I+ PMD +T++++ +Y Sbjct: 385 EVPDYYEVIKEPMDLSTMEQRLEADSY 411
>GCN5_YEAST (Q03330) Histone acetyltransferase GCN5 (EC 2.3.1.48)| Length = 439 Score = 28.9 bits (63), Expect = 3.2 Identities = 12/27 (44%), Positives = 18/27 (66%) Frame = -2 Query: 304 ELPDYNDAIEHPMDFNTVKRKHARSAY 224 E+PDY D I+ PMD +T++ K + Y Sbjct: 360 EVPDYYDFIKEPMDLSTMEIKLESNKY 386
>BRD7_CHICK (Q5ZKG2) Bromodomain-containing protein 7| Length = 651 Score = 28.9 bits (63), Expect = 3.2 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = -2 Query: 298 PDYNDAIEHPMDFNTVKRKHARSAYHLI 215 P Y+ I++PMDF+T+K K + Y I Sbjct: 166 PGYSMIIKNPMDFSTMKEKIKNNGYQSI 193
>CBP1_CAEEL (P34545) Protein cbp-1| Length = 2056 Score = 28.5 bits (62), Expect = 4.2 Identities = 10/20 (50%), Positives = 15/20 (75%) Frame = -2 Query: 301 LPDYNDAIEHPMDFNTVKRK 242 +PDY++ I+ PMD TV +K Sbjct: 900 IPDYHEIIKRPMDLETVHKK 919
>YK82_SCHPO (Q9HGP4) Hypothetical bromodomain protein C631.02| Length = 727 Score = 28.1 bits (61), Expect = 5.5 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -2 Query: 298 PDYNDAIEHPMDFNTVKRKHARSAY 224 PDY I+HPMD T++ K + Y Sbjct: 428 PDYFKVIKHPMDLGTMQNKLNHNEY 452
>GCN5_CANGA (Q6FTW5) Histone acetyltransferase GCN5 (EC 2.3.1.48)| Length = 546 Score = 28.1 bits (61), Expect = 5.5 Identities = 11/27 (40%), Positives = 18/27 (66%) Frame = -2 Query: 304 ELPDYNDAIEHPMDFNTVKRKHARSAY 224 E+PDY + I+ PMD +T++ K + Y Sbjct: 467 EVPDYYEFIKEPMDLSTMELKLENNKY 493
>BAZ2B_HUMAN (Q9UIF8) Bromodomain adjacent to zinc finger domain 2B (hWALp4)| Length = 1972 Score = 27.7 bits (60), Expect = 7.1 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -2 Query: 301 LPDYNDAIEHPMDFNTVKRKHARSAY 224 +P Y I+ PMDF+T++ K + Y Sbjct: 1898 VPGYKKVIKKPMDFSTIREKLSSGQY 1923
>GCN5_ASHGO (Q756G9) Histone acetyltransferase GCN5 (EC 2.3.1.48)| Length = 452 Score = 27.7 bits (60), Expect = 7.1 Identities = 11/27 (40%), Positives = 18/27 (66%) Frame = -2 Query: 304 ELPDYNDAIEHPMDFNTVKRKHARSAY 224 E+PDY + I+ PMD +T++ K + Y Sbjct: 373 EVPDYYEFIKEPMDLSTMEIKLENNRY 399
>TIF1A_HUMAN (O15164) Transcription intermediary factor 1-alpha (TIF1-alpha)| (Tripartite motif protein 24) (RING finger protein 82) Length = 1050 Score = 27.3 bits (59), Expect = 9.3 Identities = 9/20 (45%), Positives = 16/20 (80%) Frame = -2 Query: 301 LPDYNDAIEHPMDFNTVKRK 242 +PDY I++PMD +T+K++ Sbjct: 932 VPDYYKIIKNPMDLSTIKKR 951
>MBB1A_HUMAN (Q9BQG0) Myb-binding protein 1A| Length = 1328 Score = 27.3 bits (59), Expect = 9.3 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +2 Query: 122 RTIMQQARQPCNPEADHHFNKILSLI 199 R + Q RQP +P A +HFN L L+ Sbjct: 906 RLVQQAGRQPDSPTALYHFNASLYLL 931
>TIF1A_MOUSE (Q64127) Transcription intermediary factor 1-alpha (TIF1-alpha)| (Tripartite motif protein 24) Length = 1051 Score = 27.3 bits (59), Expect = 9.3 Identities = 9/20 (45%), Positives = 16/20 (80%) Frame = -2 Query: 301 LPDYNDAIEHPMDFNTVKRK 242 +PDY I++PMD +T+K++ Sbjct: 933 VPDYYKIIKNPMDLSTIKKR 952 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 50,922,426 Number of Sequences: 219361 Number of extensions: 903153 Number of successful extensions: 1770 Number of sequences better than 10.0: 33 Number of HSP's better than 10.0 without gapping: 1726 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1770 length of database: 80,573,946 effective HSP length: 98 effective length of database: 59,076,568 effective search space used: 1417837632 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)