| Clone Name | rbasd15a07 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | KR151_CAPHI (Q6R645) Keratin-associated protein 15-1 (Keratin-as... | 32 | 0.29 | 2 | MT3_BOVIN (P37359) Metallothionein-3 (MT-3) (Metallothionein-III... | 29 | 3.2 | 3 | GTA_NPVAC (P41447) Probable global transactivator (EC 3.6.1.-) (... | 28 | 5.4 | 4 | MT2_COLLI (P15787) Metallothionein-2 (MT-2) (Metallothionein-II)... | 28 | 7.1 | 5 | MYOD_DICDI (P34109) Myosin ID heavy chain | 27 | 9.3 |
|---|
>KR151_CAPHI (Q6R645) Keratin-associated protein 15-1 (Keratin-associated| protein 15.1) Length = 136 Score = 32.3 bits (72), Expect = 0.29 Identities = 22/52 (42%), Positives = 25/52 (48%) Frame = +2 Query: 110 PCQSHYTSALKSGNIGQTKGKYIYMSTSVQVTDASKYCHHRQNRCSPTMTSS 265 PCQ+ YT +L SGNIG G + ST Q N CSPT SS Sbjct: 85 PCQTIYTGSLGSGNIG--LGSFGCGSTGFQSLGCG------SNFCSPTYVSS 128
>MT3_BOVIN (P37359) Metallothionein-3 (MT-3) (Metallothionein-III) (MT-III)| (Growth inhibitory factor) (GIF) Length = 68 Score = 28.9 bits (63), Expect = 3.2 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = +3 Query: 45 SDPVRCSCKRAATFRRTCFCCCPA 116 SDP +C A+ +++C CCPA Sbjct: 17 SDPCKCEGCTCASCKKSCCSCCPA 40
>GTA_NPVAC (P41447) Probable global transactivator (EC 3.6.1.-) (ATP-dependent| helicase GTA) Length = 506 Score = 28.1 bits (61), Expect = 5.4 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = +2 Query: 152 IGQTKGKYIYMSTSVQVTDASKYCHHRQNR 241 +GQTK Y+Y +V+ KY RQ++ Sbjct: 452 MGQTKNTYVYKMLNVEDNSIEKYIKQRQDK 481
>MT2_COLLI (P15787) Metallothionein-2 (MT-2) (Metallothionein-II) (MT-II)| Length = 63 Score = 27.7 bits (60), Expect = 7.1 Identities = 11/22 (50%), Positives = 14/22 (63%), Gaps = 2/22 (9%) Frame = +3 Query: 60 CSCK--RAATFRRTCFCCCPAS 119 C CK R + R++C CCPAS Sbjct: 20 CKCKNCRCQSCRKSCCSCCPAS 41
>MYOD_DICDI (P34109) Myosin ID heavy chain| Length = 1109 Score = 27.3 bits (59), Expect = 9.3 Identities = 13/26 (50%), Positives = 17/26 (65%) Frame = -3 Query: 127 VMGLAGQQQKQVLRNVAALLQLQRTG 50 V+GL +QK+V R VAA+L L G Sbjct: 253 VIGLTDSEQKEVFRLVAAILYLGNVG 278 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 54,857,546 Number of Sequences: 219361 Number of extensions: 1075673 Number of successful extensions: 2944 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2913 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2943 length of database: 80,573,946 effective HSP length: 99 effective length of database: 58,857,207 effective search space used: 1412572968 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)