| Clone Name | rbasd14i10 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | EPHB1_HUMAN (P54762) Ephrin type-B receptor 1 precursor (EC 2.7.... | 31 | 2.4 | 2 | WNT9B_MOUSE (O35468) Protein Wnt-9b precursor (Wnt-15) (Wnt-14b) | 30 | 4.0 | 3 | BRCA2_RAT (O35923) Breast cancer type 2 susceptibility protein h... | 30 | 5.3 | 4 | AUXI_BOVIN (Q27974) Auxilin | 30 | 5.3 | 5 | XKR4_PANTR (Q49LS4) XK-related protein 4 | 29 | 6.9 | 6 | XKR4_HUMAN (Q5GH76) XK-related protein 4 | 29 | 6.9 | 7 | PDLI7_CHICK (Q679P3) PDZ and LIM domain protein 7 (LIM mineraliz... | 29 | 9.0 |
|---|
>EPHB1_HUMAN (P54762) Ephrin type-B receptor 1 precursor (EC 2.7.10.1)| (Tyrosine-protein kinase receptor EPH-2) (NET) (HEK6) (ELK) Length = 984 Score = 30.8 bits (68), Expect = 2.4 Identities = 19/59 (32%), Positives = 24/59 (40%), Gaps = 7/59 (11%) Frame = +3 Query: 351 WCSPGAPSSRRPGLAPRP-------PSGTLVAVEEPAGCSCCSPSGYVRPLASGAWCAC 506 W P + +PG P P+GT A +E GCS C PS P + C C Sbjct: 246 WMVPIGRCTCKPGYEPENSVACKACPAGTFKASQEAEGCSHC-PSNSRSPAEASPICTC 303
>WNT9B_MOUSE (O35468) Protein Wnt-9b precursor (Wnt-15) (Wnt-14b)| Length = 359 Score = 30.0 bits (66), Expect = 4.0 Identities = 22/53 (41%), Positives = 27/53 (50%) Frame = +3 Query: 345 WIWCSPGAPSSRRPGLAPRPPSGTLVAVEEPAGCSCCSPSGYVRPLASGAWCA 503 W PG P+ GLAPRP G LV +E+ S C PS Y P +G C+ Sbjct: 264 WAPAKPGGPAK---GLAPRP--GDLVYMEDSP--SFCRPSKY-SPGTAGRVCS 308
>BRCA2_RAT (O35923) Breast cancer type 2 susceptibility protein homolog (Fanconi| anemia group D1 protein homolog) Length = 3343 Score = 29.6 bits (65), Expect = 5.3 Identities = 19/65 (29%), Positives = 24/65 (36%), Gaps = 14/65 (21%) Frame = +3 Query: 351 WCSPGAPSSRRP--------------GLAPRPPSGTLVAVEEPAGCSCCSPSGYVRPLAS 488 W +P +R P G PR + P SCC+P+G PLA Sbjct: 3118 WSTPNKDPTREPYPASTCSASDLASGGQLPRSSPTDQQSYRSPL--SCCTPTGKSTPLAH 3175 Query: 489 GAWCA 503 AW A Sbjct: 3176 SAWMA 3180
>AUXI_BOVIN (Q27974) Auxilin| Length = 910 Score = 29.6 bits (65), Expect = 5.3 Identities = 17/42 (40%), Positives = 23/42 (54%), Gaps = 2/42 (4%) Frame = +3 Query: 33 YTPIITHDEVHEYRTGHG--YMNISHTHTGRQVLIMYHLRST 152 YT + + EYR G ++ +S T G V+ MYHLRST Sbjct: 262 YTTCADFERMKEYRVQDGKIFIPLSITVQGDVVVSMYHLRST 303
>XKR4_PANTR (Q49LS4) XK-related protein 4| Length = 650 Score = 29.3 bits (64), Expect = 6.9 Identities = 14/27 (51%), Positives = 15/27 (55%) Frame = +3 Query: 387 GLAPRPPSGTLVAVEEPAGCSCCSPSG 467 GLAP PSG+ EE AG CC G Sbjct: 33 GLAPGLPSGSGAEDEEAAGGGCCPDGG 59
>XKR4_HUMAN (Q5GH76) XK-related protein 4| Length = 650 Score = 29.3 bits (64), Expect = 6.9 Identities = 14/27 (51%), Positives = 15/27 (55%) Frame = +3 Query: 387 GLAPRPPSGTLVAVEEPAGCSCCSPSG 467 GLAP PSG+ EE AG CC G Sbjct: 33 GLAPGLPSGSGAEDEEAAGGGCCPDGG 59
>PDLI7_CHICK (Q679P3) PDZ and LIM domain protein 7 (LIM mineralization protein)| Length = 416 Score = 28.9 bits (63), Expect = 9.0 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = +3 Query: 357 SPGAPSSRRPGLAPRPPSGT 416 SPGA PGLAPR P+ T Sbjct: 159 SPGAAMKTEPGLAPRTPAAT 178 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 67,875,062 Number of Sequences: 219361 Number of extensions: 1289469 Number of successful extensions: 4183 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 3953 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4179 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 3970331829 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)