| Clone Name | rbasd14h22 |
|---|---|
| Clone Library Name | barley_pub |
>SYNE1_HUMAN (Q8NF91) Nesprin-1 (Nuclear envelope spectrin repeat protein 1)| (Synaptic nuclear envelope protein 1) (Syne-1) (Myocyte nuclear envelope protein 1) (Myne-1) (Enaptin) Length = 8797 Score = 32.7 bits (73), Expect = 0.84 Identities = 17/48 (35%), Positives = 23/48 (47%) Frame = +2 Query: 302 DDILEAK*RQQQRYSWASNGDTDTGGRGCPASGCSSHQRWSGAFGSCS 445 + +L+ QQ SW+S + DT G P SG S+ R G CS Sbjct: 8657 EKLLDVSSSQQDLSSWSSADELDTSGSVSPTSGRSTPNRQKTPRGKCS 8704
>CRYL1_PONPY (Q5RDZ2) Lambda-crystallin homolog| Length = 318 Score = 32.7 bits (73), Expect = 0.84 Identities = 12/41 (29%), Positives = 22/41 (53%) Frame = -2 Query: 431 TPPTISGDCCSRTPDTPDHLCQCRRWTPKSIFAVAVISPRV 309 T ++ D C + PD P+HL R+W + + +A + +V Sbjct: 275 TAEKVNQDMCMKVPDDPEHLAARRQWRDECLMRLAKLKSQV 315
>CRYL1_HUMAN (Q9Y2S2) Lambda-crystallin homolog| Length = 318 Score = 32.7 bits (73), Expect = 0.84 Identities = 12/41 (29%), Positives = 22/41 (53%) Frame = -2 Query: 431 TPPTISGDCCSRTPDTPDHLCQCRRWTPKSIFAVAVISPRV 309 T ++ D C + PD P+HL R+W + + +A + +V Sbjct: 275 TAEKVNQDMCMKVPDDPEHLAARRQWRDECLMRLAKLKSQV 315
>CRYL1_MOUSE (Q99KP3) Lambda-crystallin homolog| Length = 318 Score = 32.0 bits (71), Expect = 1.4 Identities = 11/37 (29%), Positives = 20/37 (54%) Frame = -2 Query: 431 TPPTISGDCCSRTPDTPDHLCQCRRWTPKSIFAVAVI 321 T +S D C + PD P+HL R+W + ++++ Sbjct: 275 TVERVSEDMCMKVPDDPEHLAARRQWRDDCLMKLSIL 311
>ISPDF_BARQU (Q6G164) IspD/ispF bifunctional enzyme [Includes:| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase (EC 2.7.7.60) (4-diphosphocytidyl-2C-methyl-D-erythritol synthase) (MEP cytidylyltransferase) (MCT); 2-C-methyl-D-erythritol 2,4-cyclod Length = 391 Score = 31.6 bits (70), Expect = 1.9 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = -2 Query: 317 PRVCHPGRCRARHPGCRSLQLVGHPVESQL 228 P +CH RC +HP ++ LV HP + Q+ Sbjct: 27 PVICHTVRCFCQHPAITTIILVIHPEDRQI 56
>RFAK_ECOLI (P27242) Lipopolysaccharide 1,2-N-acetylglucosaminetransferase (EC| 2.4.1.56) Length = 357 Score = 31.6 bits (70), Expect = 1.9 Identities = 21/66 (31%), Positives = 32/66 (48%), Gaps = 1/66 (1%) Frame = -2 Query: 509 IFVAALDHLRRHPLPVD-ALDHRCSCRTPPTISGDCCSRTPDTPDHLCQCRRWTPKSIFA 333 I+ AL + VD AL H + PT++ SRTP+ P HL W+P + Sbjct: 271 IYTVALTKYSDFVISVDTALVHIAAAYHKPTLAFYPNSRTPEYPSHLI----WSPNHHKS 326 Query: 332 VAVISP 315 + ++SP Sbjct: 327 IQIVSP 332
>DECA_DROSI (P91706) Protein decapentaplegic precursor (Protein DPP-C)| Length = 593 Score = 30.8 bits (68), Expect = 3.2 Identities = 19/51 (37%), Positives = 25/51 (49%) Frame = +2 Query: 26 NEHQATSFKEQRLHFKTSLNYRES*HLFASSSTRG*HQLPQKASVFIVSTT 178 N H + KEQR H K S ++R AS+ST HQ S+F+ T Sbjct: 134 NNHNKMAVKEQRSHHKKSHHHRSHQPKQASASTES-HQSSSIESIFVEEPT 183
>NUCM_PARTE (P15689) NADH-ubiquinone oxidoreductase 49 kDa subunit (EC 1.6.5.3)| (EC 1.6.99.3) (NADH dehydrogenase subunit 7) Length = 400 Score = 29.3 bits (64), Expect = 9.3 Identities = 15/44 (34%), Positives = 22/44 (50%) Frame = -2 Query: 353 TPKSIFAVAVISPRVCHPGRCRARHPGCRSLQLVGHPVESQLLA 222 +PK F V ++S P RC+ R P LQ++ + LLA Sbjct: 339 SPKGEFGVTLVSDGSNKPYRCKVRSPAYHHLQVLPKMSKGHLLA 382
>DL_DROME (P10041) Neurogenic locus protein delta precursor| Length = 833 Score = 29.3 bits (64), Expect = 9.3 Identities = 20/65 (30%), Positives = 25/65 (38%), Gaps = 3/65 (4%) Frame = -2 Query: 449 HRCSCRTPPTISGDCCSRTPDTPD-HLCQCRR-WTPKSIFA-VAVISPRVCHPGRCRARH 279 + C P +G C P T + C C W+ K V S + CH G CR Sbjct: 333 YSCDADVNPCQNGGTCIDEPHTKTGYKCHCANGWSGKMCEEKVLTCSDKPCHQGICRNVR 392 Query: 278 PGCRS 264 PG S Sbjct: 393 PGLGS 397 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 77,766,584 Number of Sequences: 219361 Number of extensions: 1440162 Number of successful extensions: 3583 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 3401 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3582 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5367617986 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)