| Clone Name | rbasd14f16 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | FSHR_MACEU (Q6YNB6) Follicle-stimulating hormone receptor precur... | 31 | 3.2 | 2 | CNG12_ARATH (Q8GWD2) Probable cyclic nucleotide-gated ion channe... | 30 | 9.4 | 3 | ISW1_YEAST (P38144) Chromatin remodelling complex ATPase chain I... | 30 | 9.4 |
|---|
>FSHR_MACEU (Q6YNB6) Follicle-stimulating hormone receptor precursor (FSH-R)| (Follitropin receptor) Length = 694 Score = 31.2 bits (69), Expect = 3.2 Identities = 19/73 (26%), Positives = 31/73 (42%) Frame = -1 Query: 569 KSIKHICARSPLDQSSFTNVARRATHTILALSGIAHNKDRVVATPFPFPSHCCHACDGRE 390 K++K + ARS + + N+ + A +V +PSHCC + R Sbjct: 239 KNLKKLKARSAYNFKTLPNLDKFA---------------ELVEANLTYPSHCCAFANWRR 283 Query: 389 PAFLMRTICSSCF 351 AF + IC+ F Sbjct: 284 QAFELHPICNKSF 296
>CNG12_ARATH (Q8GWD2) Probable cyclic nucleotide-gated ion channel 12 (Cyclic| nucleotide-and calmodulin-regulated ion channel 12) Length = 649 Score = 29.6 bits (65), Expect = 9.4 Identities = 14/35 (40%), Positives = 20/35 (57%) Frame = -1 Query: 281 AGISLSLSLYWCHSFNYRQLERLYGYERVNECWIA 177 AG +L+L LY HS+ + L ER ++CW A Sbjct: 199 AGAALNLFLYMLHSYVFGAFWYLSSIERKSKCWRA 233
>ISW1_YEAST (P38144) Chromatin remodelling complex ATPase chain ISW1 (EC| 3.6.1.-) Length = 1129 Score = 29.6 bits (65), Expect = 9.4 Identities = 26/106 (24%), Positives = 41/106 (38%), Gaps = 18/106 (16%) Frame = +3 Query: 369 SSHEKRW--------LSAVTG----------MATMARKRKRCCNNPILVVRNPGQR*DGV 494 SS +K+W L AV G + + + ++CCN+P L DG Sbjct: 434 SSMQKKWYKKILEKDLDAVNGSNGSKESKTRLLNIMMQLRKCCNHPYLF--------DGA 485 Query: 495 CRSPCYVRERRLIQWGPGTNVLDALLDNRNQLVLGICYFSEIASTL 632 P Y + L+ VLD LL + + FS+++ L Sbjct: 486 EPGPPYTTDEHLVYNAAKLQVLDKLLKKLKEEGSRVLIFSQMSRLL 531 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 98,075,859 Number of Sequences: 219361 Number of extensions: 1999172 Number of successful extensions: 4961 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4796 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4955 length of database: 80,573,946 effective HSP length: 109 effective length of database: 56,663,597 effective search space used: 7139613222 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)