| Clone Name | rbasd14d16 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | YQ52_SCHPO (O74419) Hypothetical protein C162.02c in chromosome III | 30 | 1.2 | 2 | PHND_ECOLI (P16682) Phosphonates-binding periplasmic protein pre... | 29 | 2.7 | 3 | NUDEL_DROME (P98159) Serine protease nudel precursor (EC 3.4.21.-) | 28 | 8.0 |
|---|
>YQ52_SCHPO (O74419) Hypothetical protein C162.02c in chromosome III| Length = 981 Score = 30.4 bits (67), Expect = 1.2 Identities = 12/28 (42%), Positives = 21/28 (75%) Frame = -2 Query: 203 REMEYLIRIHLLLVCSSLEKNDEHARER 120 R +EYL+++++ +VC E +DE A+ER Sbjct: 659 RFLEYLVKLNISVVCLVRESSDEAAKER 686
>PHND_ECOLI (P16682) Phosphonates-binding periplasmic protein precursor| Length = 338 Score = 29.3 bits (64), Expect = 2.7 Identities = 21/62 (33%), Positives = 29/62 (46%) Frame = -3 Query: 265 DSSSENVSDLLPFCKDLQFATGKWNT*FGFIYCWYVPPWKKMTSMPGNGLLMSIVISSSD 86 DS N++DLL KDL F G N+ GF+ +PG + IS+SD Sbjct: 128 DSPINNLNDLLAKRKDLTFGNGDPNSTSGFL-------------VPGYYVFAKNNISASD 174 Query: 85 FR 80 F+ Sbjct: 175 FK 176
>NUDEL_DROME (P98159) Serine protease nudel precursor (EC 3.4.21.-)| Length = 2616 Score = 27.7 bits (60), Expect = 8.0 Identities = 12/27 (44%), Positives = 18/27 (66%) Frame = +1 Query: 169 NK*IRIKYSISLLQIADPCRMEANLKH 249 NK R++ + L + DP RMEAN++H Sbjct: 123 NKKHRMRRDLHGLDLLDPVRMEANMQH 149 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 38,888,583 Number of Sequences: 219361 Number of extensions: 720064 Number of successful extensions: 1630 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1622 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1630 length of database: 80,573,946 effective HSP length: 65 effective length of database: 66,315,481 effective search space used: 1591571544 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)