| Clone Name | rbasd13n11 |
|---|---|
| Clone Library Name | barley_pub |
>PYRD_BUCAP (Q8K9I5) Dihydroorotate dehydrogenase (EC 1.3.3.1) (Dihydroorotate| oxidase) (DHOdehase) (DHODase) (DHOD) Length = 336 Score = 29.3 bits (64), Expect = 2.7 Identities = 18/60 (30%), Positives = 34/60 (56%) Frame = -1 Query: 226 EGYLGYSGGKLDDVTVVVSIVRKSEL*AVDKLYFYSDLMAMAAASCEPYSDRVRMLAFGL 47 +G +G + GK D + +I K L ++K+YFY+ +A+ +S P + +R L +G+ Sbjct: 133 KGIIGINIGKNKDTKIEDAI--KDYLICIEKIYFYASYIAINISS--PNTINLRKLQYGI 188
>HEXA_MOUSE (P29416) Beta-hexosaminidase alpha chain precursor (EC 3.2.1.52)| (N-acetyl-beta-glucosaminidase) (Beta-N-acetylhexosaminidase) (Hexosaminidase A) Length = 528 Score = 28.5 bits (62), Expect = 4.7 Identities = 12/33 (36%), Positives = 20/33 (60%) Frame = -2 Query: 174 CPLLGNLNYKLLISCISTRILWPWPQQVASHIR 76 C L +L ++C++T LWPWPQ + ++ R Sbjct: 4 CRLWVSLLLAAALACLATA-LWPWPQYIQTYHR 35
>Y2049_PROAC (Q6A651) UPF0085 protein PPA2049| Length = 294 Score = 28.5 bits (62), Expect = 4.7 Identities = 19/45 (42%), Positives = 25/45 (55%) Frame = -1 Query: 268 SGSGRSPFSDAALAEGYLGYSGGKLDDVTVVVSIVRKSEL*AVDK 134 S SG++P S YLGY G K +V +V I +EL AVD+ Sbjct: 158 SRSGKTPLSI------YLGYLGYKTVNVPLVPGIAPPTELAAVDR 196
>XKDO_BACSU (P54334) Phage-like element PBSX protein xkdO| Length = 1332 Score = 28.1 bits (61), Expect = 6.1 Identities = 14/37 (37%), Positives = 22/37 (59%) Frame = -1 Query: 271 GSGSGRSPFSDAALAEGYLGYSGGKLDDVTVVVSIVR 161 G G+ R+P +AA A GY+ G +D+V + S+ R Sbjct: 1161 GMGNIRNPIHNAAAAIGYIKSRYGSIDNVPGIKSLKR 1197
>GLGB_SHEON (Q8EGU7) 1,4-alpha-glucan branching enzyme (EC 2.4.1.18) (Glycogen| branching enzyme) (BE) (1,4-alpha-D-glucan:1,4-alpha-D-glucan 6-glucosyl-transferase) Length = 746 Score = 28.1 bits (61), Expect = 6.1 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -3 Query: 113 YGHGRSKLRAIFGSSPNACIWAEEXPIPGLR 21 Y +GR ++R+ S NAC W E + GLR Sbjct: 386 YNYGRGEVRSFLLS--NACYWLREFHLDGLR 414
>COBA2_MOUSE (Q64739) Collagen alpha-2(XI) chain precursor| Length = 1736 Score = 27.7 bits (60), Expect = 8.0 Identities = 13/38 (34%), Positives = 19/38 (50%) Frame = +2 Query: 152 FRFPNNGHDNCYIIQLAPGVAQIAFCERRVRERAPPGP 265 FRF ++G D ++ AQ + R+ R PPGP Sbjct: 454 FRFGSSGGDKGPVVAAQEAQAQAILQQARLALRGPPGP 491
>HEXA_RAT (Q641X3) Beta-hexosaminidase alpha chain precursor (EC 3.2.1.52)| (N-acetyl-beta-glucosaminidase) (Beta-N-acetylhexosaminidase) (Hexosaminidase A) Length = 528 Score = 27.7 bits (60), Expect = 8.0 Identities = 14/34 (41%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Frame = -2 Query: 174 CPLLGNLNYKLLISCISTRILWPWPQQV-ASHIR 76 C L +L ++C++T LWPWPQ + SH R Sbjct: 4 CRLWVSLLLAAALACLATA-LWPWPQYIQTSHRR 36 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 39,176,304 Number of Sequences: 219361 Number of extensions: 697254 Number of successful extensions: 1988 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1958 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1988 length of database: 80,573,946 effective HSP length: 65 effective length of database: 66,315,481 effective search space used: 1591571544 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)