| Clone Name | rbasd13m21 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | Y1693_CLOPE (Q8XJR2) Hypothetical zinc metalloprotease CPE1693 (... | 29 | 3.9 | 2 | Y1322_FUSNN (P58819) Hypothetical zinc metalloprotease FN1322 (E... | 28 | 6.7 | 3 | HIS7_METTH (Q50504) Imidazoleglycerol-phosphate dehydratase (EC ... | 28 | 8.8 | 4 | KDSA_CHLCV (Q824W7) 2-dehydro-3-deoxyphosphooctonate aldolase (E... | 28 | 8.8 |
|---|
>Y1693_CLOPE (Q8XJR2) Hypothetical zinc metalloprotease CPE1693 (EC 3.4.24.-)| Length = 335 Score = 29.3 bits (64), Expect = 3.9 Identities = 13/35 (37%), Positives = 22/35 (62%) Frame = -3 Query: 422 AIGSFSAVFXRHEAAHFLVAYLXGLPISGCSLDIG 318 A+ +FSA+ HE HF+VA L G+ + ++ +G Sbjct: 6 ALLAFSALILVHELGHFIVAKLNGIYVEEFAIGMG 40
>Y1322_FUSNN (P58819) Hypothetical zinc metalloprotease FN1322 (EC 3.4.24.-)| Length = 339 Score = 28.5 bits (62), Expect = 6.7 Identities = 13/37 (35%), Positives = 19/37 (51%) Frame = -3 Query: 422 AIGSFSAVFXRHEAAHFLVAYLXGLPISGCSLDIGKQ 312 A+ + HE HFL A L +P+S S+ +G Q Sbjct: 6 AVVMLGLIIFVHELGHFLTAKLFKMPVSEFSIGMGPQ 42
>HIS7_METTH (Q50504) Imidazoleglycerol-phosphate dehydratase (EC 4.2.1.19)| (IGPD) Length = 194 Score = 28.1 bits (61), Expect = 8.8 Identities = 14/38 (36%), Positives = 20/38 (52%), Gaps = 3/38 (7%) Frame = +1 Query: 22 DGLVVGDLKSEEDG*LANDLVV---LQTHSSLSGHGDH 126 D V+GD+KS+ G L V + H+S+ G DH Sbjct: 125 DDAVIGDVKSQNIGHFIESLAVSAAMNIHASVRGRNDH 162
>KDSA_CHLCV (Q824W7) 2-dehydro-3-deoxyphosphooctonate aldolase (EC 2.5.1.55)| (Phospho-2-dehydro-3-deoxyoctonate aldolase) (3-deoxy-D-manno-octulosonic acid 8-phosphate synthetase) (KDO-8-phosphate synthetase) (KDO 8-P synthase) (KDOPS) Length = 269 Score = 28.1 bits (61), Expect = 8.8 Identities = 10/32 (31%), Positives = 20/32 (62%) Frame = -3 Query: 122 SPWPDRLLWVWSTTRSLANQPSSSLFRSPTTN 27 +P+ DR+ W++ ++ AN+ S + +R P N Sbjct: 33 TPYADRIHWIFKSSYDKANRSSINSYRGPGLN 64 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 61,093,317 Number of Sequences: 219361 Number of extensions: 1188211 Number of successful extensions: 2947 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2842 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2947 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2278320915 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)