| Clone Name | rbasd13m10 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | YFBW_ECOLI (Q47377) Inner membrane protein yfbW | 30 | 6.3 |
|---|
>YFBW_ECOLI (Q47377) Inner membrane protein yfbW| Length = 111 Score = 29.6 bits (65), Expect = 6.3 Identities = 17/49 (34%), Positives = 26/49 (53%), Gaps = 1/49 (2%) Frame = -2 Query: 460 ANVTSIAGVYCRWQLVLFLRFSLGMKLLIFWLPI*LAYLS-RDALWTLV 317 A++ S+AG C+ Q F+ + K ++ WL + LA L LW LV Sbjct: 9 ASLLSVAGQLCQKQATCFVAINKRRKHIVLWLGLALACLGLAMVLWLLV 57 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 83,398,663 Number of Sequences: 219361 Number of extensions: 1750613 Number of successful extensions: 4540 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 4299 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4539 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4757699440 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)