| Clone Name | rbasd14a13 |
|---|---|
| Clone Library Name | barley_pub |
>AMP2B_ARATH (Q56Y85) Methionine aminopeptidase 2B (EC 3.4.11.18) (MetAP 2B)| (MAP 2B) (Peptidase M 2B) Length = 439 Score = 138 bits (348), Expect = 3e-33 Identities = 63/70 (90%), Positives = 67/70 (95%) Frame = -3 Query: 403 SFGTLAFCRRYLDRIGETKYLMALKNLCDVGIVQPYPPLCDVRGSYVSQFEHTILLRPTC 224 +F TLAFCRRYLDRIGETKYLMALKNLCD GIVQPYPPLCDV+GSYVSQFEHTILLRPTC Sbjct: 370 NFSTLAFCRRYLDRIGETKYLMALKNLCDSGIVQPYPPLCDVKGSYVSQFEHTILLRPTC 429 Query: 223 KEVISRGXDY 194 KEV+S+G DY Sbjct: 430 KEVLSKGDDY 439
>AMPM2_RAT (P38062) Methionine aminopeptidase 2 (EC 3.4.11.18) (MetAP 2)| (Peptidase M 2) (Initiation factor 2-associated 67 kDa glycoprotein) (p67) (p67eIF2) Length = 478 Score = 134 bits (337), Expect = 5e-32 Identities = 58/70 (82%), Positives = 67/70 (95%) Frame = -3 Query: 403 SFGTLAFCRRYLDRIGETKYLMALKNLCDVGIVQPYPPLCDVRGSYVSQFEHTILLRPTC 224 +FGTLAFCRR+LDR+GE+KYLMALKNLCD+GIV PYPPLCD++GSY +QFEHTILLRPTC Sbjct: 409 NFGTLAFCRRWLDRLGESKYLMALKNLCDLGIVDPYPPLCDIKGSYTAQFEHTILLRPTC 468 Query: 223 KEVISRGXDY 194 KEV+SRG DY Sbjct: 469 KEVVSRGDDY 478
>AMPM2_MOUSE (O08663) Methionine aminopeptidase 2 (EC 3.4.11.18) (MetAP 2)| (Peptidase M 2) (Initiation factor 2-associated 67 kDa glycoprotein) (p67) (p67eIF2) Length = 478 Score = 134 bits (337), Expect = 5e-32 Identities = 58/70 (82%), Positives = 67/70 (95%) Frame = -3 Query: 403 SFGTLAFCRRYLDRIGETKYLMALKNLCDVGIVQPYPPLCDVRGSYVSQFEHTILLRPTC 224 +FGTLAFCRR+LDR+GE+KYLMALKNLCD+GIV PYPPLCD++GSY +QFEHTILLRPTC Sbjct: 409 NFGTLAFCRRWLDRLGESKYLMALKNLCDLGIVDPYPPLCDIKGSYTAQFEHTILLRPTC 468 Query: 223 KEVISRGXDY 194 KEV+SRG DY Sbjct: 469 KEVVSRGDDY 478
>AMPM2_HUMAN (P50579) Methionine aminopeptidase 2 (EC 3.4.11.18) (MetAP 2)| (Peptidase M 2) (Initiation factor 2-associated 67 kDa glycoprotein) (p67) (p67eIF2) Length = 478 Score = 134 bits (337), Expect = 5e-32 Identities = 58/70 (82%), Positives = 67/70 (95%) Frame = -3 Query: 403 SFGTLAFCRRYLDRIGETKYLMALKNLCDVGIVQPYPPLCDVRGSYVSQFEHTILLRPTC 224 +FGTLAFCRR+LDR+GE+KYLMALKNLCD+GIV PYPPLCD++GSY +QFEHTILLRPTC Sbjct: 409 NFGTLAFCRRWLDRLGESKYLMALKNLCDLGIVDPYPPLCDIKGSYTAQFEHTILLRPTC 468 Query: 223 KEVISRGXDY 194 KEV+SRG DY Sbjct: 469 KEVVSRGDDY 478
>AMP2A_ARATH (Q9FV49) Methionine aminopeptidase 2A (EC 3.4.11.18) (MetAP 2A)| (MAP 2A) (Peptidase M 2A) Length = 441 Score = 131 bits (330), Expect = 3e-31 Identities = 57/70 (81%), Positives = 66/70 (94%) Frame = -3 Query: 403 SFGTLAFCRRYLDRIGETKYLMALKNLCDVGIVQPYPPLCDVRGSYVSQFEHTILLRPTC 224 +F TLAFCRRYLDR+GETKYLMALKNLCD GI++P PP+CDV+GSY+SQFEHTILLRPTC Sbjct: 372 NFSTLAFCRRYLDRLGETKYLMALKNLCDSGIIEPCPPVCDVKGSYISQFEHTILLRPTC 431 Query: 223 KEVISRGXDY 194 KE+IS+G DY Sbjct: 432 KEIISKGDDY 441
>AMPM2_YEAST (P38174) Methionine aminopeptidase 2 (EC 3.4.11.18) (MetAP 2)| (Peptidase M 2) Length = 421 Score = 98.6 bits (244), Expect = 3e-21 Identities = 46/70 (65%), Positives = 54/70 (77%) Frame = -3 Query: 403 SFGTLAFCRRYLDRIGETKYLMALKNLCDVGIVQPYPPLCDVRGSYVSQFEHTILLRPTC 224 +FGTL FCRRYLDR+G+ KYL AL NL G+VQ YPPL D+ GSY +QFEHTILL Sbjct: 352 NFGTLPFCRRYLDRLGQEKYLFALNNLVRHGLVQDYPPLNDIPGSYTAQFEHTILLHAHK 411 Query: 223 KEVISRGXDY 194 KEV+S+G DY Sbjct: 412 KEVVSKGDDY 421
>AMPM2_ENCHE (Q6XMH6) Methionine aminopeptidase 2 (EC 3.4.11.18) (MetAP 2)| (Peptidase M 2) (MetAP2) (MAP-2) Length = 358 Score = 65.9 bits (159), Expect = 2e-11 Identities = 34/72 (47%), Positives = 47/72 (65%), Gaps = 2/72 (2%) Frame = -3 Query: 403 SFGTLAFCRRYLD--RIGETKYLMALKNLCDVGIVQPYPPLCDVRGSYVSQFEHTILLRP 230 SFGTL F R+LD + E L ++ L +G+ PYPPL D+ GS V+QFEHT+ L Sbjct: 287 SFGTLPFSPRHLDYYNLVEGSALKSVNLLTMMGLFTPYPPLNDIDGSKVAQFEHTVYLSE 346 Query: 229 TCKEVISRGXDY 194 + KE+++RG DY Sbjct: 347 SGKEILTRGDDY 358
>AMPM2_ENCIN (Q6XMH7) Methionine aminopeptidase 2 (EC 3.4.11.18) (MetAP 2)| (Peptidase M 2) (MetAP2) (MAP-2) Length = 358 Score = 64.7 bits (156), Expect = 5e-11 Identities = 34/72 (47%), Positives = 45/72 (62%), Gaps = 2/72 (2%) Frame = -3 Query: 403 SFGTLAFCRRYLDRIG--ETKYLMALKNLCDVGIVQPYPPLCDVRGSYVSQFEHTILLRP 230 SFGTL F R+LD E L ++ L +G+ PYPPL D+ GS V+QFEHT+ L Sbjct: 287 SFGTLPFSPRHLDHYNLVEGGSLKSVNLLTMMGLFTPYPPLNDIDGSKVAQFEHTVYLSE 346 Query: 229 TCKEVISRGXDY 194 KE+++RG DY Sbjct: 347 NGKEILTRGDDY 358
>AMPM2_ENCCU (Q8SR45) Methionine aminopeptidase 2 (EC 3.4.11.18) (MetAP 2)| (Peptidase M 2) (MetAP2) (MAP-2) Length = 358 Score = 62.8 bits (151), Expect = 2e-10 Identities = 34/72 (47%), Positives = 45/72 (62%), Gaps = 2/72 (2%) Frame = -3 Query: 403 SFGTLAFCRRYLDRIGETK--YLMALKNLCDVGIVQPYPPLCDVRGSYVSQFEHTILLRP 230 S GTL F R+LD G K L ++ L +G++ PYPPL D+ G V+QFEHT+ L Sbjct: 287 SLGTLPFSPRHLDYYGLVKGGSLKSVNLLTMMGLLTPYPPLNDIDGCKVAQFEHTVYLSE 346 Query: 229 TCKEVISRGXDY 194 KEV++RG DY Sbjct: 347 HGKEVLTRGDDY 358
>AMPM_PYRFU (P56218) Methionine aminopeptidase (EC 3.4.11.18) (MAP) (Peptidase| M) Length = 295 Score = 43.9 bits (102), Expect = 9e-05 Identities = 23/56 (41%), Positives = 34/56 (60%), Gaps = 1/56 (1%) Frame = -3 Query: 400 FGTLAFCRRYLDR-IGETKYLMALKNLCDVGIVQPYPPLCDVRGSYVSQFEHTILL 236 +GTL F R+L + E + +ALK L G + YP L ++R V+QFEHTI++ Sbjct: 230 YGTLPFAYRWLQNDMPEGQLKLALKTLEKAGAIYGYPVLKEIRNGIVAQFEHTIIV 285
>AMPM_PYRKO (Q5JGD1) Methionine aminopeptidase (EC 3.4.11.18) (MAP) (Peptidase| M) Length = 295 Score = 42.7 bits (99), Expect = 2e-04 Identities = 23/57 (40%), Positives = 35/57 (61%), Gaps = 1/57 (1%) Frame = -3 Query: 403 SFGTLAFCRRYL-DRIGETKYLMALKNLCDVGIVQPYPPLCDVRGSYVSQFEHTILL 236 ++ TL F R+L D + E + +AL L G + YP L +VRG V+QFEHT+++ Sbjct: 230 NYKTLPFAYRWLQDFLPEGQLKLALAQLEKAGAIYAYPILREVRGGMVAQFEHTVIV 286
>YD43_CAEEL (P50581) Hypothetical protein T27A8.3 in chromosome X| Length = 182 Score = 42.0 bits (97), Expect = 3e-04 Identities = 18/26 (69%), Positives = 23/26 (88%) Frame = -3 Query: 403 SFGTLAFCRRYLDRIGETKYLMALKN 326 +F TLAFCR ++DR+ ETKYLMALK+ Sbjct: 126 NFATLAFCRCWIDRLEETKYLMALKD 151
>AMPM_PYRHO (O58362) Methionine aminopeptidase (EC 3.4.11.18) (MAP) (Peptidase| M) Length = 295 Score = 40.4 bits (93), Expect = 0.001 Identities = 22/56 (39%), Positives = 35/56 (62%), Gaps = 1/56 (1%) Frame = -3 Query: 400 FGTLAFCRRYLD-RIGETKYLMALKNLCDVGIVQPYPPLCDVRGSYVSQFEHTILL 236 + TL F R+L + E + +AL++L G + YP L ++RG V+QFEHTI++ Sbjct: 230 YKTLPFAYRWLQGEMPEGQLKLALRSLERSGALYGYPVLREIRGGMVTQFEHTIIV 285
>AMPM_ARCFU (O28438) Methionine aminopeptidase (EC 3.4.11.18) (MAP) (Peptidase| M) Length = 291 Score = 38.5 bits (88), Expect = 0.004 Identities = 18/56 (32%), Positives = 34/56 (60%) Frame = -3 Query: 403 SFGTLAFCRRYLDRIGETKYLMALKNLCDVGIVQPYPPLCDVRGSYVSQFEHTILL 236 ++ TL F +R+L + + + + L G+++ YP L +V G VSQ+EHT+++ Sbjct: 230 NYKTLPFAKRWLKKAPD----IIISKLAREGVLRAYPVLTEVSGGLVSQWEHTLIV 281
>AMPM_PYRAB (Q9UYT4) Methionine aminopeptidase (EC 3.4.11.18) (MAP) (Peptidase| M) Length = 295 Score = 38.1 bits (87), Expect = 0.005 Identities = 21/56 (37%), Positives = 33/56 (58%), Gaps = 1/56 (1%) Frame = -3 Query: 400 FGTLAFCRRYLD-RIGETKYLMALKNLCDVGIVQPYPPLCDVRGSYVSQFEHTILL 236 + TL F R+L + E + +AL+ L G + YP L ++R V+QFEHTI++ Sbjct: 230 YKTLPFAYRWLQGEMPEGQLKLALRTLEKSGALYGYPVLREIRNGLVTQFEHTIIV 285
>AMPM_SULSO (P95963) Methionine aminopeptidase (EC 3.4.11.18) (MAP) (Peptidase| M) Length = 301 Score = 36.6 bits (83), Expect = 0.015 Identities = 19/58 (32%), Positives = 31/58 (53%), Gaps = 2/58 (3%) Frame = -3 Query: 400 FGTLAFCRRYLDRIGET--KYLMALKNLCDVGIVQPYPPLCDVRGSYVSQFEHTILLR 233 F L F R+L + +KNL G ++ YP L +++ VSQFEHT++++ Sbjct: 233 FNYLPFSERWLKEFSTNVDELRNNIKNLVKKGALRGYPILIEIKKGVVSQFEHTVIVK 290
>AMPM_METTH (O27355) Methionine aminopeptidase (EC 3.4.11.18) (MAP) (Peptidase| M) Length = 299 Score = 32.3 bits (72), Expect = 0.28 Identities = 17/56 (30%), Positives = 32/56 (57%), Gaps = 1/56 (1%) Frame = -3 Query: 400 FGTLAFCRRYLDRIGETKYLMA-LKNLCDVGIVQPYPPLCDVRGSYVSQFEHTILL 236 + L F +R+L+ + K L A ++ L + PY L + G+ V+Q+EHT+++ Sbjct: 234 YHALPFAQRWLEEYFDAKRLNASMRMLIQSRAIYPYHVLREKSGAMVAQWEHTVIV 289
>OR83A_DROME (Q9VNB3) Putative odorant receptor 83a| Length = 453 Score = 30.4 bits (67), Expect = 1.1 Identities = 30/131 (22%), Positives = 53/131 (40%), Gaps = 3/131 (2%) Frame = -3 Query: 385 FCRRYLDRIGETKYLMALKNLCDVGIVQPYPPLCDVR-GSYVSQFEHTILLRPTCKEVIS 209 FC L + + Y++ N+ ++ +Q DV G Y E L+ K + Sbjct: 232 FCS--LKNVLASSYVLMGANMTELNQLQAEQSAADVEPGQYAYSVEEETPLQELLK--VG 287 Query: 208 RGXDY*LVLRLLFVPAVASD*CFTTILGDLCSLWIK-WHIRIGQIMQLHCTLLFSEIK-I 35 D+ RL FV + L + S + W ++IG++ L C + F K Sbjct: 288 SSMDFSSAFRLSFVRCIQHHRYIVAALKKIESFYSPIWFVKIGEVTFLMCLVAFVSTKST 347 Query: 34 CGNWFVRIATV 2 N F+R+ ++ Sbjct: 348 AANSFMRMVSL 358
>PA2G4_MOUSE (P50580) Proliferation-associated protein 2G4| (Proliferation-associated protein 1) (Protein p38-2G4) (Mpp1) (IRES-specific cellular trans-acting factor 45 kDa) (ITAF45) Length = 393 Score = 30.0 bits (66), Expect = 1.4 Identities = 16/51 (31%), Positives = 26/51 (50%) Frame = -3 Query: 355 ETKYLMALKNLCDVGIVQPYPPLCDVRGSYVSQFEHTILLRPTCKEVISRG 203 E K M + ++QP+ L + G +V+QF+ T+LL P I+ G Sbjct: 285 EKKARMGVVECAKHELLQPFNVLYEKEGEFVAQFKFTVLLMPNGPMRITSG 335
>PA2G4_HUMAN (Q9UQ80) Proliferation-associated protein 2G4 (Cell cycle protein| p38-2G4 homolog) (hG4-1) (ErbB3-binding protein 1) Length = 393 Score = 30.0 bits (66), Expect = 1.4 Identities = 16/51 (31%), Positives = 26/51 (50%) Frame = -3 Query: 355 ETKYLMALKNLCDVGIVQPYPPLCDVRGSYVSQFEHTILLRPTCKEVISRG 203 E K M + ++QP+ L + G +V+QF+ T+LL P I+ G Sbjct: 285 EKKARMGVVECAKHELLQPFNVLYEKEGEFVAQFKFTVLLMPNGPMRITSG 335
>OXAA_MYCCT (P43042) Membrane protein oxaA| Length = 388 Score = 28.9 bits (63), Expect = 3.1 Identities = 13/34 (38%), Positives = 23/34 (67%) Frame = -1 Query: 180 VSSLYLPLQAISVLLPSWVTCVRYGSNGTSESDK 79 + ++YLPLQA+S+LLP+ + + S +E+ K Sbjct: 281 ILAIYLPLQAVSMLLPTLLQMKKQKSITLTEAQK 314
>BUK_CLOPE (Q9ZNE5) Butyrate kinase (EC 2.7.2.7) (BK)| Length = 356 Score = 28.9 bits (63), Expect = 3.1 Identities = 14/58 (24%), Positives = 26/58 (44%) Frame = +2 Query: 86 DSDVPFDP*RTQVTQDGSKTLIACNGRYKEETQHQSVVXASGYDFFTGWPEQNGVLKL 259 D D PF P R G + +G+Y +E ++ +V G+ + + ++KL Sbjct: 206 DGDGPFSPERAGGVPSGELLEMCFSGKYSKEEVYKKLVGKGGFVAYANTNDARDLIKL 263
>AMZ2_RAT (Q400C7) Archaemetzincin-2 (EC 3.-.-.-) (Archeobacterial| metalloproteinase-like protein 2) Length = 359 Score = 28.5 bits (62), Expect = 4.0 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = -1 Query: 129 WVTCVRYGSNGTSESDK*CSYIVPFCFLRLK 37 W+ C+ GSN ESD+ + P C +L+ Sbjct: 267 WLACLMQGSNHLEESDRRPLNVCPICLRKLQ 297
>AMZ2_MOUSE (Q400C8) Archaemetzincin-2 (EC 3.-.-.-) (Archeobacterial| metalloproteinase-like protein 2) Length = 359 Score = 28.5 bits (62), Expect = 4.0 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = -1 Query: 129 WVTCVRYGSNGTSESDK*CSYIVPFCFLRLK 37 W+ C+ GSN ESD+ + P C +L+ Sbjct: 267 WLACLMQGSNHLEESDRRPLNVCPICLRKLQ 297
>ISN1_ASHGO (Q75EG6) IMP-specific 5'-nucleotidase 1 (EC 3.1.3.-)| Length = 425 Score = 28.5 bits (62), Expect = 4.0 Identities = 20/66 (30%), Positives = 34/66 (51%), Gaps = 2/66 (3%) Frame = +2 Query: 185 HQSVVXASGYDFFTGWPEQN-GVLK-LGHIASPHVAQRRVRLNNANIT*IFQCHEIFGLA 358 H +V A+GYD + + G+L+ L P+ A+RR+ + +F+C+E G A Sbjct: 175 HVGIVTAAGYDDAENYERRLFGLLRRLERADLPNEAKRRLCVMGGESNFLFRCYERDGRA 234 Query: 359 DAVQVP 376 +VP Sbjct: 235 GFERVP 240
>AMZ2_MACFA (Q4R684) Archaemetzincin-2 (EC 3.-.-.-) (Archeobacterial| metalloproteinase-like protein 2) Length = 360 Score = 28.1 bits (61), Expect = 5.2 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = -1 Query: 129 WVTCVRYGSNGTSESDK*CSYIVPFCFLRLK 37 W+ C+ GSN ESD+ + P C +L+ Sbjct: 267 WLACLMQGSNHLEESDRRPLNLCPICLRKLQ 297
>CATA2_HORVU (P55308) Catalase isozyme 2 (EC 1.11.1.6)| Length = 494 Score = 28.1 bits (61), Expect = 5.2 Identities = 15/47 (31%), Positives = 25/47 (53%), Gaps = 3/47 (6%) Frame = +2 Query: 254 KLGHIASPHVAQRRVRLNNANIT*IFQC-HEIFGL--ADAVQVPAAK 385 K+ H A + +R V A+ F+C H++ GL AD ++ P A+ Sbjct: 50 KIAHFARERIPERVVHARGASAKGFFECTHDVTGLTCADFLRAPGAR 96
>RPOC2_SOYBN (Q8HVY3) DNA-directed RNA polymerase beta'' chain (EC 2.7.7.6)| (PEP) (Plastid-encoded RNA polymerase beta'' subunit) (RNA polymerase beta'' subunit) Length = 1386 Score = 28.1 bits (61), Expect = 5.2 Identities = 12/30 (40%), Positives = 19/30 (63%) Frame = +2 Query: 14 SYKPVSTNFNLRKQKGTM*LHYLSDSDVPF 103 SY+ S +F++RK + M +HYLS + F Sbjct: 481 SYRSGSVSFSIRKDQDQMNIHYLSTGERDF 510
>ZSWM1_HUMAN (Q9BR11) Zinc finger SWIM domain-containing protein 1| Length = 485 Score = 27.7 bits (60), Expect = 6.8 Identities = 34/123 (27%), Positives = 52/123 (42%), Gaps = 10/123 (8%) Frame = -3 Query: 397 GTLAFCRRYLDRIGETKYLMALKNLCDVGIVQPYPPLCDVRGSYVSQFEHTILLRPTCKE 218 G LA ++ IG M ++ L D VQP PP Y +Q H C+ Sbjct: 344 GELAVVQKSTHLIGSGSEKMNIQILEDTHKVQPQPPAS--CSCYFNQAFHL-----PCRH 396 Query: 217 VISRGXDY*LVLRLLFVPAVASD*CFT---TILGDLCSLWIKWHI-------RIGQIMQL 68 +++ VL+ +PA + C T +ILG S + H+ +GQ++Q Sbjct: 397 ILAMLSARRQVLQPDMLPAQWTAGCATSLDSILGSKWSETLDKHLAVTHLTEEVGQLLQ- 455 Query: 67 HCT 59 HCT Sbjct: 456 HCT 458
>HEMA_BRV2 (P0C0W0) Hemagglutinin-esterase homolog precursor (EC 3.1.1.53)| (HE) Length = 416 Score = 27.3 bits (59), Expect = 8.9 Identities = 20/58 (34%), Positives = 30/58 (51%), Gaps = 4/58 (6%) Frame = -1 Query: 183 CVSSLYLP----LQAISVLLPSWVTCVRYGSNGTSESDK*CSYIVPFCFLRLKFVETG 22 C ++ LP L +S +P+ V V GS+GT+ K ++VPFC+L TG Sbjct: 156 CRTNKQLPDNPRLALLSDTVPTSVQFVLPGSSGTTICTK---HLVPFCYLNHGCFTTG 210
>HEMA_BRV1 (P0C0V9) Hemagglutinin-esterase homolog precursor (EC 3.1.1.53)| (HE) Length = 416 Score = 27.3 bits (59), Expect = 8.9 Identities = 20/58 (34%), Positives = 30/58 (51%), Gaps = 4/58 (6%) Frame = -1 Query: 183 CVSSLYLP----LQAISVLLPSWVTCVRYGSNGTSESDK*CSYIVPFCFLRLKFVETG 22 C ++ LP L +S +P+ V V GS+GT+ K ++VPFC+L TG Sbjct: 156 CRTNKQLPDNPRLALLSDTVPTSVQFVLPGSSGTTICTK---HLVPFCYLNHGCFTTG 210
>ZSWM1_MOUSE (Q9CWV7) Zinc finger SWIM domain-containing protein 1| Length = 455 Score = 27.3 bits (59), Expect = 8.9 Identities = 31/123 (25%), Positives = 53/123 (43%), Gaps = 10/123 (8%) Frame = -3 Query: 397 GTLAFCRRYLDRIGETKYLMALKNLCDVGIVQPYPPLCDVRGSYVSQFEHTILLRPTCKE 218 G LA ++ + IG M+++ L D VQP PP Y +Q H C+ Sbjct: 314 GELAVVQKSMHLIGSGSEKMSIQILEDTHTVQPQPPAS--CSCYFNQAFHL-----PCRH 366 Query: 217 VISRGXDY*LVLRLLFVPAVASD*C---FTTILGDLCSLWIKWHI-------RIGQIMQL 68 +++ VL+ +PA + C +ILG S + H+ +G+++Q Sbjct: 367 ILAMLSARQQVLQPDMLPAQWTSGCASSLDSILGSKWSASLDKHLAVTLLTEEVGRLLQ- 425 Query: 67 HCT 59 HC+ Sbjct: 426 HCS 428
>UBP3_MOUSE (Q91W36) Ubiquitin carboxyl-terminal hydrolase 3 (EC 3.1.2.15)| (Ubiquitin thioesterase 3) (Ubiquitin-specific-processing protease 3) (Deubiquitinating enzyme 3) Length = 520 Score = 27.3 bits (59), Expect = 8.9 Identities = 10/28 (35%), Positives = 13/28 (46%) Frame = -1 Query: 264 CPSLSTPFCSGQPVKKSYPEAXTTDWCC 181 CP LS+ C P +P + WCC Sbjct: 3 CPHLSSSVCIA-PDSAKFPNGSPSSWCC 29
>AMPM_METJA (Q58725) Methionine aminopeptidase (EC 3.4.11.18) (MAP) (Peptidase| M) Length = 294 Score = 27.3 bits (59), Expect = 8.9 Identities = 14/45 (31%), Positives = 22/45 (48%) Frame = -3 Query: 340 MALKNLCDVGIVQPYPPLCDVRGSYVSQFEHTILLRPTCKEVISR 206 +AL +L + YP L + V Q EHTIL+ E+ ++ Sbjct: 250 LALNSLIRASCIYGYPILKERENGIVGQAEHTILITENGVEITTK 294
>UBP3_HUMAN (Q9Y6I4) Ubiquitin carboxyl-terminal hydrolase 3 (EC 3.1.2.15)| (Ubiquitin thioesterase 3) (Ubiquitin-specific-processing protease 3) (Deubiquitinating enzyme 3) Length = 521 Score = 27.3 bits (59), Expect = 8.9 Identities = 10/28 (35%), Positives = 13/28 (46%) Frame = -1 Query: 264 CPSLSTPFCSGQPVKKSYPEAXTTDWCC 181 CP LS+ C P +P + WCC Sbjct: 3 CPHLSSSVCIA-PDSAKFPNGSPSSWCC 29
>Y392_MYCLE (Q49736) Hypothetical glycosyl hydrolase ML0392 (EC 3.2.1.-)| Length = 792 Score = 27.3 bits (59), Expect = 8.9 Identities = 17/73 (23%), Positives = 29/73 (39%) Frame = +2 Query: 83 SDSDVPFDP*RTQVTQDGSKTLIACNGRYKEETQHQSVVXASGYDFFTGWPEQNGVLKLG 262 +D +V DP Q + G L+ + R + + +GYD W + VL + Sbjct: 312 ADVEVEGDPESQQAVRFGLFHLLQASARAERRAIPSKGLTGTGYDGHAFWDTEGFVLPVL 371 Query: 263 HIASPHVAQRRVR 301 +PH +R Sbjct: 372 TYTAPHAVADALR 384 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 63,217,574 Number of Sequences: 219361 Number of extensions: 1273345 Number of successful extensions: 2787 Number of sequences better than 10.0: 36 Number of HSP's better than 10.0 without gapping: 2743 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2784 length of database: 80,573,946 effective HSP length: 110 effective length of database: 56,444,236 effective search space used: 1354661664 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)