| Clone Name | rbasd13l02 |
|---|---|
| Clone Library Name | barley_pub |
>NAC22_ARATH (Q84TE6) NAC domain-containing protein 21/22 (ANAC021) (ANAC022)| Length = 324 Score = 37.0 bits (84), Expect = 0.056 Identities = 28/75 (37%), Positives = 38/75 (50%), Gaps = 7/75 (9%) Frame = -3 Query: 607 KEDWVLCRVFYKSRTTSPRPPSEEACTFFTELDLPTMPPLA-PLI------GAYIAFDSG 449 KEDWVLCRVF+K+ + +C F E ++PPL P I +Y++ D Sbjct: 160 KEDWVLCRVFHKNTEGVICRDNMGSC--FDETASASLPPLMDPYINFDQEPSSYLSDDHH 217 Query: 448 TTMNTTEQVSCFSGL 404 +N E V CFS L Sbjct: 218 YIIN--EHVPCFSNL 230
>WOX1_ARATH (Q6X7K0) WUSCHEL-related homeobox 1 (PFS2-like protein)| Length = 350 Score = 31.2 bits (69), Expect = 3.1 Identities = 10/23 (43%), Positives = 18/23 (78%) Frame = -1 Query: 594 CYAGCSTRAEQPAQGHHLKKPAH 526 C GC T+ E+P++ +HL++PA+ Sbjct: 178 CSVGCDTQPEKPSRDYHLEEPAN 200
>CENG3_HUMAN (Q96P47) Centaurin-gamma 3 (ARF-GAP with GTP-binding protein-like,| ankyrin repeat and pleckstrin homology domains 3) (AGAP-3) (MR1-interacting protein) (MRIP-1) (CRAM-associated GTPase) (CRAG) Length = 875 Score = 31.2 bits (69), Expect = 3.1 Identities = 22/67 (32%), Positives = 28/67 (41%) Frame = -1 Query: 417 ASPACRHYRSGDR*ASGTCWAGTTLRRRPSGQH*ATCQVTTIPSWSCLQTGARRTACHRC 238 AS A H +R S + WAG RP G H +C V++ WS T H Sbjct: 468 ASSASLH---SERPLSSSAWAGP----RPEGLHQRSCSVSSADQWSEATTSLPPGMQHPA 520 Query: 237 GHPSESL 217 P+E L Sbjct: 521 SGPAEVL 527
>IF2G_HALSA (Q9HNK9) Translation initiation factor 2 gamma subunit| (eIF-2-gamma) (aIF2-gamma) Length = 414 Score = 30.4 bits (67), Expect = 5.2 Identities = 20/51 (39%), Positives = 27/51 (52%) Frame = +2 Query: 401 RQAGEAGHLLGGVHRGAAVEGDVGADEGREGRHSRKVQLGEECAGFFRWWP 553 R E G LLGGV G+ V+G++ A + E R R+V+ G G W P Sbjct: 223 RPGTEWGGLLGGVIGGSLVDGELEAGDELELRPGREVEEG----GKTEWRP 269
>NAC2_ARATH (Q39013) NAC domain-containing protein 2 (ANAC002)| Length = 289 Score = 30.4 bits (67), Expect = 5.2 Identities = 21/72 (29%), Positives = 30/72 (41%), Gaps = 9/72 (12%) Frame = -3 Query: 604 EDWVLCRVFYKSRTTSPRPPSE---------EACTFFTELDLPTMPPLAPLIGAYIAFDS 452 +DWVLCR++ K T R P E TE+ +P P + DS Sbjct: 148 DDWVLCRIYNKKGATERRGPPPPVVYGDEIMEEKPKVTEMVMPPPPQQTSEFAYFDTSDS 207 Query: 451 GTTMNTTEQVSC 416 ++TT+ SC Sbjct: 208 VPKLHTTDS-SC 218
>RHBT2_MOUSE (Q91V93) Rho-related BTB domain-containing protein 2 (Deleted in| breast cancer 2 gene protein homolog) Length = 728 Score = 30.0 bits (66), Expect = 6.9 Identities = 13/24 (54%), Positives = 15/24 (62%) Frame = -2 Query: 380 GELRGPAGLGQP*EEGHQDSTEQH 309 GEL GP+G G P E H+ EQH Sbjct: 303 GELGGPSGSGGPRPEDHRSHPEQH 326
>PHNC_CAUCR (Q9AB70) Phosphonates import ATP-binding protein phnC (EC 3.6.3.28)| Length = 264 Score = 30.0 bits (66), Expect = 6.9 Identities = 18/41 (43%), Positives = 24/41 (58%) Frame = -2 Query: 605 GRLGAMQGVLQEQNNQPKATI*RSLHILHRAGPSDYAAPRA 483 GR+ +QG+L PK T ++ LHR G S+YAA RA Sbjct: 114 GRIPVVQGLL---GWWPKETRDATMAALHRVGVSEYAAQRA 151
>PTFLB_ECOLI (P32154) Fructose-like PTS system EIIBC component [Includes:| Fructose-like phosphotransferase enzyme IIB component (EC 2.7.1.69) (PTS system fructose-like EIIB component); Fructose-like permease IIC component (PTS system fructose-like EIIC co Length = 483 Score = 29.6 bits (65), Expect = 9.0 Identities = 17/38 (44%), Positives = 21/38 (55%), Gaps = 5/38 (13%) Frame = -3 Query: 508 LPTMPP-----LAPLIGAYIAFDSGTTMNTTEQVSCFS 410 L T+PP A L+GA +AFD G +N T CFS Sbjct: 296 LNTIPPSMKFAAAFLVGAMLAFDMGGPINKTAWFFCFS 333 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 93,206,864 Number of Sequences: 219361 Number of extensions: 1923982 Number of successful extensions: 6240 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 5644 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6235 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6769072002 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)