| Clone Name | rbasd13k19 |
|---|---|
| Clone Library Name | barley_pub |
>ACVS_CEPAC (P25464) N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine| synthase (EC 6.3.2.26) (Delta-(L-alpha-aminoadipyl)-L-cysteinyl-D-valine synthetase) (ACV synthetase) (ACVS) Length = 3712 Score = 29.3 bits (64), Expect = 2.5 Identities = 20/60 (33%), Positives = 27/60 (45%), Gaps = 3/60 (5%) Frame = +1 Query: 196 PFFDRR---TKLTAYQDLLEINQHALQLVSGFDLLPEIHSAPLPTCTKDDQDQVTQRGVH 366 P FD + L+A +LL QLV +LLPE A L D D T++ +H Sbjct: 204 PLFDTMVIDSFLSALHNLLSAVTKPSQLVRDIELLPEYQVAQLEKWNNTDGDYPTEKRLH 263
>PUR2_RHIME (Q92RL0) Phosphoribosylamine--glycine ligase (EC 6.3.4.13) (GARS)| (Glycinamide ribonucleotide synthetase) (Phosphoribosylglycinamide synthetase) Length = 423 Score = 28.5 bits (62), Expect = 4.2 Identities = 19/69 (27%), Positives = 31/69 (44%), Gaps = 13/69 (18%) Frame = +2 Query: 50 KMTMIRFGAREYSLVQHISSTP*-TRRWEAKGKG------------REPLAQAISFCTFH 190 K+ +I G RE++L I+ +P T+ + A G E + FC H Sbjct: 2 KVLLIGSGGREHALAWKIAQSPRLTKLYAAPGNPGIAEEAAIVDLHTENHEDVVDFCRTH 61 Query: 191 AVPFLIEGP 217 A+ F++ GP Sbjct: 62 AIDFVVVGP 70
>AHR_DELLE (Q95LD9) Aryl hydrocarbon receptor precursor (Ah receptor) (AhR)| Length = 845 Score = 27.7 bits (60), Expect = 7.2 Identities = 14/34 (41%), Positives = 20/34 (58%), Gaps = 2/34 (5%) Frame = -1 Query: 331 PWCKSEVVLNESQGANQIHSPT--GAHAGLFPTN 236 P +++ +E G +Q +PT G HAGLFP N Sbjct: 498 PMGSDDILKHEQIGQSQEMNPTLSGDHAGLFPDN 531
>BGLS_RUMAL (P15885) Beta-glucosidase (EC 3.2.1.21) (Gentiobiase) (Cellobiase)| (Beta-D-glucoside glucohydrolase) Length = 947 Score = 27.7 bits (60), Expect = 7.2 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = -1 Query: 367 HAHPFGSPGPGHPWCKSEVVLNES 296 H + +G G PWC+ E+ L++S Sbjct: 93 HPYDYGEGWGGEPWCQEEMPLDDS 116
>S13A4_HUMAN (Q9UKG4) Solute carrier family 13 member 4 (Na(+)/sulfate| cotransporter SUT-1) Length = 627 Score = 27.7 bits (60), Expect = 7.2 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = -3 Query: 347 TWSWSSLVQVGSGAE*ISGSKSNPLTNW 264 T W ++ VG G SGSKS+ L+ W Sbjct: 462 TMPWEIVILVGGGYALASGSKSSGLSTW 489
>SQT1_CAEEL (P12114) Cuticle collagen sqt-1 (Protein squat-1) (Protein| roller-5) Length = 324 Score = 27.7 bits (60), Expect = 7.2 Identities = 14/43 (32%), Positives = 18/43 (41%) Frame = -1 Query: 361 HPFGSPGPGHPWCKSEVVLNESQGANQIHSPTGAHAGLFPTNP 233 HP G PGP P + + G N +H P G + P P Sbjct: 234 HPIGGPGPKGP--RGDQGPTGPAGQNGLHGPPGEPGTVGPEGP 274
>N2DL4_HUMAN (Q8TD07) NKG2D ligand 4 precursor (NKG2D ligand 4) (NKG2DL4)| (N2DL-4) (Retinoic acid early transcript 1E) (Lymphocyte effector toxicity activation ligand) (RAE-1-like transcript 4) (RL-4) Length = 263 Score = 27.3 bits (59), Expect = 9.3 Identities = 8/15 (53%), Positives = 13/15 (86%) Frame = -1 Query: 340 PGHPWCKSEVVLNES 296 PG PWC+++V LN++ Sbjct: 45 PGQPWCEAQVFLNKN 59
>PSF2_YEAST (P40359) DNA replication complex GINS protein PSF2 (Partner of Sld| five 2) Length = 213 Score = 27.3 bits (59), Expect = 9.3 Identities = 14/36 (38%), Positives = 22/36 (61%) Frame = +1 Query: 238 LLEINQHALQLVSGFDLLPEIHSAPLPTCTKDDQDQ 345 LLEIN+ + D L EIH+A L T++D+++ Sbjct: 175 LLEINELRPFITEIMDKLREIHTASLTAGTENDEEE 210 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 58,802,452 Number of Sequences: 219361 Number of extensions: 1209096 Number of successful extensions: 2879 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 2803 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2876 length of database: 80,573,946 effective HSP length: 97 effective length of database: 59,295,929 effective search space used: 1423102296 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)