| Clone Name | rbasd13k15 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | SIF2_DROME (P91620) Protein still life, isoforms C/SIF type 2 | 31 | 4.0 | 2 | SIF1_DROME (P91621) Protein still life, isoform SIF type 1 | 31 | 4.0 |
|---|
>SIF2_DROME (P91620) Protein still life, isoforms C/SIF type 2| Length = 2061 Score = 30.8 bits (68), Expect = 4.0 Identities = 21/58 (36%), Positives = 30/58 (51%), Gaps = 2/58 (3%) Frame = +1 Query: 286 QGNQFSQRGTKGSKIQLGCPMLQVTFSTWSTLQEQRN*QHAR--RSSEAPSNKQPFMI 453 +G + SQ+GT K LG +T ST STL AR +SS P++ QP ++ Sbjct: 1973 EGEEDSQQGTIRPKATLGRTPNHLTLSTTSTLSVGSTGSQARLIQSSHPPASYQPVLM 2030
>SIF1_DROME (P91621) Protein still life, isoform SIF type 1| Length = 2072 Score = 30.8 bits (68), Expect = 4.0 Identities = 21/58 (36%), Positives = 30/58 (51%), Gaps = 2/58 (3%) Frame = +1 Query: 286 QGNQFSQRGTKGSKIQLGCPMLQVTFSTWSTLQEQRN*QHAR--RSSEAPSNKQPFMI 453 +G + SQ+GT K LG +T ST STL AR +SS P++ QP ++ Sbjct: 1984 EGEEDSQQGTIRPKATLGRTPNHLTLSTTSTLSVGSTGSQARLIQSSHPPASYQPVLM 2041 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 91,891,441 Number of Sequences: 219361 Number of extensions: 1778902 Number of successful extensions: 4006 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3883 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4002 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6769072002 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)