| Clone Name | rbasd13k06 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | SMBT2_MOUSE (Q5DTW2) Scm-like with four MBT domains protein 2 | 31 | 3.4 | 2 | PER_LOXAL (Q25221) Period circadian protein (Fragment) | 30 | 7.5 |
|---|
>SMBT2_MOUSE (Q5DTW2) Scm-like with four MBT domains protein 2| Length = 938 Score = 30.8 bits (68), Expect = 3.4 Identities = 13/43 (30%), Positives = 21/43 (48%) Frame = +1 Query: 316 GAFLWLLVPC*ETPFSDLSLDAEGLNVLIKGWSKAXXXXXXXP 444 G LWL + ETP D+ +D + +++ GW +A P Sbjct: 433 GRLLWLHLEGLETPMPDIIVDMDSMDIFPVGWCEANSYPLTTP 475
>PER_LOXAL (Q25221) Period circadian protein (Fragment)| Length = 109 Score = 29.6 bits (65), Expect = 7.5 Identities = 19/56 (33%), Positives = 29/56 (51%), Gaps = 3/56 (5%) Frame = +1 Query: 112 PKYNHL*HLDN*TKTFNSRRKSFVV---PHE*RVDHGNSSSAESTRALMRHA*STG 270 P YN L + +N + FNS+ + V PHE + S+ A S R+ +RH +G Sbjct: 9 PSYNQLNYNENLQRFFNSKPITAPVDVDPHEVEQSYDASTDARSFRSPLRHFEGSG 64 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 83,047,588 Number of Sequences: 219361 Number of extensions: 1568231 Number of successful extensions: 2835 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2786 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2835 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5653129581 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)