| Clone Name | rbasd13h06 |
|---|---|
| Clone Library Name | barley_pub |
>NLTP3_HORVU (Q43766) Nonspecific lipid-transfer protein 3 precursor (LTP 3)| (CW20) (CW-20) (CW-19) Length = 118 Score = 40.0 bits (92), Expect = 0.001 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -3 Query: 311 VSVPFPISMSTDCNKVH 261 VSVPFPISMSTDCNKVH Sbjct: 102 VSVPFPISMSTDCNKVH 118
>NLTP3_ARATH (Q9LLR7) Nonspecific lipid-transfer protein 3 precursor (LTP 3)| Length = 115 Score = 31.2 bits (69), Expect = 0.69 Identities = 11/16 (68%), Positives = 15/16 (93%) Frame = -3 Query: 311 VSVPFPISMSTDCNKV 264 VS+P+PISMST+CN + Sbjct: 99 VSIPYPISMSTNCNNI 114
>SCA_LILLO (Q9SW93) Stigma/stylar cysteine-rich adhesin precursor (Lipid| transfer protein) Length = 113 Score = 30.8 bits (68), Expect = 0.90 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = -3 Query: 311 VSVPFPISMSTDCNKV 264 V++P+PI M TDCNKV Sbjct: 97 VNIPYPIRMQTDCNKV 112
>NLTPA_BRAOT (Q42641) Nonspecific lipid-transfer protein A precursor (LTP A)| (Wax-associated protein 9A) Length = 118 Score = 29.6 bits (65), Expect = 2.0 Identities = 12/16 (75%), Positives = 14/16 (87%) Frame = -3 Query: 311 VSVPFPISMSTDCNKV 264 VSVPFPIS +T+CN V Sbjct: 102 VSVPFPISTNTNCNNV 117
>NLTP8_HORVU (Q43871) Nonspecific lipid-transfer protein Cw18 precursor (LTP| Cw-18) (PKG2316) Length = 115 Score = 29.3 bits (64), Expect = 2.6 Identities = 11/17 (64%), Positives = 14/17 (82%) Frame = -3 Query: 311 VSVPFPISMSTDCNKVH 261 VSVP+ IS S DC+K+H Sbjct: 99 VSVPYTISASVDCSKIH 115
>NU4M_PARTE (P15581) NADH-ubiquinone oxidoreductase chain 4 (EC 1.6.5.3) (NADH| dehydrogenase subunit 4) Length = 474 Score = 28.9 bits (63), Expect = 3.4 Identities = 15/35 (42%), Positives = 21/35 (60%) Frame = -2 Query: 270 QGPLAGIRYSFLRACMDALVWSLISTLMECSYVRY 166 +G + I Y FL M AL+ +L+ L+EC Y RY Sbjct: 320 KGDSSLIAYGFLFTIMHALMSTLMFFLVECIYSRY 354
>NLTP5_ORYSA (O65091) Nonspecific lipid-transfer protein 5 precursor (LTP 5)| Length = 117 Score = 28.5 bits (62), Expect = 4.5 Identities = 10/17 (58%), Positives = 15/17 (88%) Frame = -3 Query: 311 VSVPFPISMSTDCNKVH 261 V++P+ IS STDC++VH Sbjct: 101 VNIPYAISPSTDCSRVH 117
>ARGJ_ZYMMO (Q5NP13) Arginine biosynthesis bifunctional protein argJ [Includes:| Glutamate N-acetyltransferase (EC 2.3.1.35) (Ornithine acetyltransferase) (Ornithine transacetylase) (OATase); Amino-acid acetyltransferase (EC 2.3.1.1) (N-acetylglutamate syn Length = 409 Score = 28.1 bits (61), Expect = 5.8 Identities = 15/44 (34%), Positives = 24/44 (54%) Frame = -1 Query: 193 VDGVLIRTILSNKK*NKRVCLCLYLAHTLCVCAYIFTRHACTRP 62 +DG+ +RT+ + K +R L L+L V A + T+ AC P Sbjct: 19 IDGITLRTVCAGYKNWQRNDLSLFLFQPNTVVAGLTTQSACPSP 62
>NLTP_HELAN (Q39950) Nonspecific lipid-transfer protein precursor (LTP) (NsLTP)| (SDI-9) Length = 116 Score = 27.7 bits (60), Expect = 7.6 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = -3 Query: 311 VSVPFPISMSTDCNKV 264 VS+P+ IS STDC+KV Sbjct: 100 VSIPYKISPSTDCSKV 115
>NLTP4_ORYSA (Q42976) Nonspecific lipid-transfer protein 4 precursor (LTP 4)| Length = 121 Score = 27.7 bits (60), Expect = 7.6 Identities = 11/17 (64%), Positives = 14/17 (82%) Frame = -3 Query: 311 VSVPFPISMSTDCNKVH 261 VSV FPIS S DC+K++ Sbjct: 105 VSVAFPISTSVDCSKIN 121
>NLTP_BETVU (Q43748) Nonspecific lipid-transfer protein precursor (LTP)| Length = 117 Score = 27.3 bits (59), Expect = 10.0 Identities = 10/17 (58%), Positives = 14/17 (82%) Frame = -3 Query: 311 VSVPFPISMSTDCNKVH 261 VSVP+ IS +T+CN +H Sbjct: 101 VSVPYAISPNTNCNAIH 117
>DEOC2_MESFL (Q6F0H8) Deoxyribose-phosphate aldolase 2 (EC 4.1.2.4)| (Phosphodeoxyriboaldolase 2) (Deoxyriboaldolase 2) (DERA 2) Length = 212 Score = 27.3 bits (59), Expect = 10.0 Identities = 13/41 (31%), Positives = 25/41 (60%) Frame = -1 Query: 211 VELNIYVDGVLIRTILSNKK*NKRVCLCLYLAHTLCVCAYI 89 ++LN Y+D L++ + + NK V LC+ + + C+C +I Sbjct: 1 MKLNNYIDATLLKPDATLIEINKFVDLCI-IKNVRCICVHI 40
>NLTP1_SORBI (Q43193) Nonspecific lipid-transfer protein 1 precursor (LTP 1)| Length = 118 Score = 27.3 bits (59), Expect = 10.0 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = -3 Query: 311 VSVPFPISMSTDCNKV 264 VSVP+ IS STDC++V Sbjct: 102 VSVPYTISTSTDCSRV 117
>NLTP_MAIZE (P19656) Nonspecific lipid-transfer protein precursor (LTP)| (Phospholipid transfer protein) (PLTP) (Allergen Zea m 14) Length = 120 Score = 27.3 bits (59), Expect = 10.0 Identities = 10/17 (58%), Positives = 15/17 (88%) Frame = -3 Query: 311 VSVPFPISMSTDCNKVH 261 VS+P+ IS STDC++V+ Sbjct: 104 VSIPYTISTSTDCSRVN 120
>TNKS1_HUMAN (O95271) Tankyrase 1 (EC 2.4.2.30) (TANK1) (Tankyrase I) (TNKS-1)| (TRF1-interacting ankyrin-related ADP-ribose polymerase) Length = 1327 Score = 27.3 bits (59), Expect = 10.0 Identities = 18/62 (29%), Positives = 26/62 (41%) Frame = +2 Query: 86 KYICAHTQCVCKVQT*AYSFILFFIAQYRTYEHSINVDIKLHTSASMHARRKEYLIPASG 265 K +C+ C+ +S L F A Y V+ LH A +HA+ K L+P Sbjct: 667 KQLCSSQNVNCRDLEGRHSTPLHFAAGYNRVSV---VEYLLHHGADVHAKDKGGLVPLHN 723 Query: 266 PC 271 C Sbjct: 724 AC 725 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 46,422,883 Number of Sequences: 219361 Number of extensions: 895410 Number of successful extensions: 1866 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 1818 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1865 length of database: 80,573,946 effective HSP length: 79 effective length of database: 63,244,427 effective search space used: 1517866248 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)