| Clone Name | rbasd13g17 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ENV_EIAVC (P32541) Env polyprotein precursor (Coat polyprotein) ... | 33 | 0.49 | 2 | HXB3A_BRARE (O42368) Homeobox protein Hox-B3a (Hox-B3) | 32 | 1.4 | 3 | HEMH_CHLMU (Q9PJQ6) Ferrochelatase (EC 4.99.1.1) (Protoheme ferr... | 29 | 9.3 | 4 | COG5_YEAST (P53951) Conserved oligomeric Golgi complex component... | 29 | 9.3 |
|---|
>ENV_EIAVC (P32541) Env polyprotein precursor (Coat polyprotein) [Contains:| Coat protein GP90; Coat protein GP45] Length = 859 Score = 33.5 bits (75), Expect = 0.49 Identities = 21/70 (30%), Positives = 28/70 (40%), Gaps = 8/70 (11%) Frame = -3 Query: 590 SANEKAEENTMLQNVDPVTDSSNVVASGEESKPDGSGAP--------RNVWWQKQLISLY 435 S K EENTM Q DS N +A +E++ RN WW+K + L Sbjct: 22 SEKSKCEENTMFQPYCYNNDSKNSMAESKEARDQEMNLKEESKEEKRRNDWWKKGMFLLC 81 Query: 434 RSAKESNKLW 405 + LW Sbjct: 82 LAGTTGGILW 91
>HXB3A_BRARE (O42368) Homeobox protein Hox-B3a (Hox-B3)| Length = 417 Score = 32.0 bits (71), Expect = 1.4 Identities = 17/51 (33%), Positives = 26/51 (50%), Gaps = 3/51 (5%) Frame = -3 Query: 581 EKAEENTMLQNVDPVTDSSNVVASGEESKPDGSGA---PRNVWWQKQLISL 438 +++ +NT +N P S+N +SG E P GS A R + QL+ L Sbjct: 145 KESRQNTKQKNSSPSASSANAESSGGEKSPPGSAASKRARTAYTSAQLVEL 195
>HEMH_CHLMU (Q9PJQ6) Ferrochelatase (EC 4.99.1.1) (Protoheme ferro-lyase) (Heme| synthetase) Length = 317 Score = 29.3 bits (64), Expect = 9.3 Identities = 16/42 (38%), Positives = 24/42 (57%) Frame = -1 Query: 535 LTRPMLLLLAKRASLTVLEPHATCGGRSNLYRCTGALRRATS 410 L RP+ +AKR + V E +A GGRS +++ T L + S Sbjct: 40 LHRPLFSYIAKRRAHRVAEQYAYLGGRSPIFQDTEKLAQNLS 81
>COG5_YEAST (P53951) Conserved oligomeric Golgi complex component 5 (Complexed| with DOR1 protein 4) Length = 403 Score = 29.3 bits (64), Expect = 9.3 Identities = 21/68 (30%), Positives = 32/68 (47%), Gaps = 21/68 (30%) Frame = -3 Query: 593 DSANEKAEEN-------TMLQNV--DPVTDSSNVVASGEE------------SKPDGSGA 477 D+ NE E+ T+LQN+ D VT+SS +A+ + GSG Sbjct: 272 DAFNEVVEKGYNIYILETLLQNIKTDNVTNSSRSIAANKSRLGNLLSEYTSMKSKAGSGT 331 Query: 476 PRNVWWQK 453 PR+++W K Sbjct: 332 PRDLFWSK 339 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 88,546,671 Number of Sequences: 219361 Number of extensions: 1792906 Number of successful extensions: 5254 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5063 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5254 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5367617986 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)