| Clone Name | rbasd13e02 |
|---|---|
| Clone Library Name | barley_pub |
>T2EA_SCHPO (Q9P3W1) Transcription initiation factor IIE alpha subunit| (TFIIE-alpha) Length = 448 Score = 32.0 bits (71), Expect = 1.8 Identities = 15/45 (33%), Positives = 26/45 (57%) Frame = -2 Query: 483 SKVTDYDSSKEKENDGESEADLESNKGDSALDSNGLQSAKANNGI 349 +K TDY S K K + S++D+++ + S ++N L + NGI Sbjct: 369 NKSTDYGSVKRKTENLNSDSDIQNKRTKSIEENNSLPPIVSTNGI 413
>CLFA_STAAR (Q6GIK4) Clumping factor A precursor (Fibrinogen-binding protein A)| (Fibrinogen receptor A) Length = 1029 Score = 31.6 bits (70), Expect = 2.4 Identities = 16/51 (31%), Positives = 27/51 (52%), Gaps = 1/51 (1%) Frame = -2 Query: 489 ENSKVTDYDSSKEKENDGESEADLES-NKGDSALDSNGLQSAKANNGIASP 340 +++ +D DS ++D +S +D S N DS DSN + +NN + P Sbjct: 920 DSASDSDSDSDSASDSDSDSTSDTGSDNDSDSESDSNSDSDSGSNNNVVPP 970
>YDG8_SCHPO (Q10495) Hypothetical protein C26F1.08c in chromosome I| Length = 977 Score = 31.2 bits (69), Expect = 3.1 Identities = 18/37 (48%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Frame = +2 Query: 47 MNHHHS-TYTNARKQTHGCKYSRPALLYSLKHPTLAL 154 MN HH T+ RK H KYS A+ YSL P +AL Sbjct: 1 MNFHHGWTFHKLRKNEHFLKYS--AIFYSLLKPVVAL 35
>YAMP_RHOCA (P14172) Hypothetical 28.2 kDa protein in ampR 5'region| Length = 260 Score = 30.8 bits (68), Expect = 4.1 Identities = 20/58 (34%), Positives = 28/58 (48%), Gaps = 6/58 (10%) Frame = +3 Query: 360 SPLRTAARCCRERSLPCWTLDRPPTHRR------SPSPWTNRSL*PCCSPTSWRPPQL 515 SPL + R R+ SL RPP+ +R PSP + S P + SWRP ++ Sbjct: 192 SPL-PSCRVSRQGSLSACPWPRPPSPKRLSRRSPKPSPGSRNSSAPASASRSWRPARV 248
>CLFA_STAAW (Q8NXJ1) Clumping factor A precursor (Fibrinogen-binding protein A)| (Fibrinogen receptor A) Length = 946 Score = 30.4 bits (67), Expect = 5.3 Identities = 15/46 (32%), Positives = 25/46 (54%), Gaps = 1/46 (2%) Frame = -2 Query: 474 TDYDSSKEKENDGESEADLESNK-GDSALDSNGLQSAKANNGIASP 340 +D DS + +D +S +D +S+ DS DSN + +NN + P Sbjct: 842 SDSDSDSDSASDSDSGSDSDSSSDSDSESDSNSDSESGSNNNVVPP 887
>CLFA_STAAU (Q53653) Clumping factor A precursor (Fibrinogen-binding protein A)| (Fibrinogen receptor A) Length = 933 Score = 30.4 bits (67), Expect = 5.3 Identities = 15/46 (32%), Positives = 25/46 (54%), Gaps = 1/46 (2%) Frame = -2 Query: 474 TDYDSSKEKENDGESEADLESNK-GDSALDSNGLQSAKANNGIASP 340 +D DS + +D +S +D +S+ DS DSN + +NN + P Sbjct: 829 SDSDSDSDSASDSDSGSDSDSSSDSDSESDSNSDSESGSNNNVVPP 874
>CLFA_STAAC (Q5HHM8) Clumping factor A precursor (Fibrinogen-binding protein A)| (Fibrinogen receptor A) Length = 933 Score = 30.4 bits (67), Expect = 5.3 Identities = 15/46 (32%), Positives = 25/46 (54%), Gaps = 1/46 (2%) Frame = -2 Query: 474 TDYDSSKEKENDGESEADLESNK-GDSALDSNGLQSAKANNGIASP 340 +D DS + +D +S +D +S+ DS DSN + +NN + P Sbjct: 829 SDSDSDSDSASDSDSGSDSDSSSDSDSESDSNSDSESGSNNNVVPP 874
>CLFA_STAAS (Q6GB45) Clumping factor A precursor (Fibrinogen-binding protein A)| (Fibrinogen receptor A) Length = 928 Score = 30.4 bits (67), Expect = 5.3 Identities = 15/46 (32%), Positives = 25/46 (54%), Gaps = 1/46 (2%) Frame = -2 Query: 474 TDYDSSKEKENDGESEADLESNK-GDSALDSNGLQSAKANNGIASP 340 +D DS + +D +S +D +S+ DS DSN + +NN + P Sbjct: 824 SDSDSDSDSASDSDSGSDSDSSSDSDSESDSNSDSESGSNNNVVPP 869 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 72,082,355 Number of Sequences: 219361 Number of extensions: 1154112 Number of successful extensions: 3699 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 3446 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3696 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6882837918 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)