| Clone Name | rbasd13c08 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CHK2_HUMAN (O96017) Serine/threonine-protein kinase Chk2 (EC 2.7... | 32 | 1.9 | 2 | AMEL_TACAC (O97647) Amelogenin (Fragment) | 30 | 5.4 |
|---|
>CHK2_HUMAN (O96017) Serine/threonine-protein kinase Chk2 (EC 2.7.11.1) (Cds1)| Length = 543 Score = 32.0 bits (71), Expect = 1.9 Identities = 24/92 (26%), Positives = 46/92 (50%), Gaps = 2/92 (2%) Frame = -1 Query: 569 SLSVEAVIQIFAKVDHPRHLRFTAFSSGFDHEIVLFDDKFVGSGDVNQHVVAVKAKGKLD 390 +L+VE I+I K++HP ++ F D+ IVL + + G++ VV K + Sbjct: 267 ALNVETEIEILKKLNHPCIIKIKNFFDAEDYYIVL---ELMEGGELFDKVVGNKRLKEAT 323 Query: 389 VRLQVERMVF--QWTFQDGLAGTVSSPDDSLL 300 +L +M+ Q+ ++G+ P++ LL Sbjct: 324 CKLYFYQMLLAVQYLHENGIIHRDLKPENVLL 355
>AMEL_TACAC (O97647) Amelogenin (Fragment)| Length = 121 Score = 30.4 bits (67), Expect = 5.4 Identities = 16/47 (34%), Positives = 20/47 (42%) Frame = +2 Query: 269 ITPSQQTGHTLRASRPAN*QFQPTHLGKSTETPFSPLVSEHPIFPSP 409 +TP+Q H +P FQP K T P P HP+ P P Sbjct: 49 VTPTQH--HQSNLPQPGQQPFQPQFPQKPTHRPIQPQAPVHPMPPMP 93 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 97,271,635 Number of Sequences: 219361 Number of extensions: 1993581 Number of successful extensions: 5285 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5103 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5282 length of database: 80,573,946 effective HSP length: 109 effective length of database: 56,663,597 effective search space used: 7026286028 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)