| Clone Name | rbasd13a19 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | KAPR_YEAST (P07278) cAMP-dependent protein kinase regulatory sub... | 31 | 3.7 | 2 | DHYS_METKA (Q8TXD7) Probable deoxyhypusine synthase (EC 2.5.1.46... | 30 | 6.3 |
|---|
>KAPR_YEAST (P07278) cAMP-dependent protein kinase regulatory subunit (PKA| regulatory subunit) Length = 415 Score = 31.2 bits (69), Expect = 3.7 Identities = 17/57 (29%), Positives = 26/57 (45%) Frame = +1 Query: 370 PQE*RSTTDLVNNNMNLPNISIILQFSSEYHTNKHNFANHIHKKRRCNYNANDFVMF 540 P+E ++ L N +N N S LQFS+ Y + K R + A + V+F Sbjct: 5 PKESQAELQLFQNEINAANPSDFLQFSANYFNKRLEQQRAFLKAREPEFKAKNIVLF 61
>DHYS_METKA (Q8TXD7) Probable deoxyhypusine synthase (EC 2.5.1.46) (DHS)| Length = 297 Score = 30.4 bits (67), Expect = 6.3 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = +1 Query: 220 ADEAPMIEVPGVLDQIVGGFIWVLIQTH 303 ADE I PG+LD +VG +W+ Q H Sbjct: 162 ADEGVPIYSPGILDSMVGLHVWIHSQDH 189 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 107,354,813 Number of Sequences: 219361 Number of extensions: 2106450 Number of successful extensions: 4506 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4372 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4506 length of database: 80,573,946 effective HSP length: 110 effective length of database: 56,444,236 effective search space used: 8127969984 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)