| Clone Name | rbasd11n06 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | TX16_PHORI (P83893) Non-toxic venom protein PRTx16C0 | 30 | 5.2 | 2 | BCL9_PIG (Q95KQ6) B-cell lymphoma 9 protein (Bcl-9) (Fragment) | 30 | 6.8 | 3 | CADH1_ARACO (P42495) Cinnamyl-alcohol dehydrogenase 1 (EC 1.1.1.... | 30 | 8.9 | 4 | BCL9_MOUSE (Q9D219) B-cell lymphoma 9 protein (Bcl-9) | 30 | 8.9 |
|---|
>TX16_PHORI (P83893) Non-toxic venom protein PRTx16C0| Length = 64 Score = 30.4 bits (67), Expect = 5.2 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = -3 Query: 462 PNSTGEIRMGCPGKEGLLVHPI 397 PN E + GCP KEGL+ PI Sbjct: 37 PNDYNEYKFGCPCKEGLICSPI 58
>BCL9_PIG (Q95KQ6) B-cell lymphoma 9 protein (Bcl-9) (Fragment)| Length = 130 Score = 30.0 bits (66), Expect = 6.8 Identities = 19/49 (38%), Positives = 23/49 (46%), Gaps = 3/49 (6%) Frame = -2 Query: 520 QGTRPCTVDNGAIPYPVGGT---QFNRRNQNGMPGKGRPARSSNLPRSS 383 QG P +P+P G Q N G PG+G R SNLP+SS Sbjct: 61 QGFPPVQSPPQQVPFPHNGPSGGQGNFPGGMGFPGEGPLGRPSNLPQSS 109
>CADH1_ARACO (P42495) Cinnamyl-alcohol dehydrogenase 1 (EC 1.1.1.195) (CAD)| Length = 360 Score = 29.6 bits (65), Expect = 8.9 Identities = 17/60 (28%), Positives = 28/60 (46%), Gaps = 7/60 (11%) Frame = +2 Query: 356 ITATSVHSK*ATRQIG*TSRPSFPGHPILISPVELGT-------SDWIRDGTIINRARAC 514 I T +H +G ++ P PGH ++ VE+G+ D + DGTI+ + C Sbjct: 46 ICHTDIHQ--IKNDLGASNYPMVPGHEVVGEVVEVGSDVTKFKVGDCVGDGTIVGCCKTC 103
>BCL9_MOUSE (Q9D219) B-cell lymphoma 9 protein (Bcl-9)| Length = 1425 Score = 29.6 bits (65), Expect = 8.9 Identities = 19/49 (38%), Positives = 23/49 (46%), Gaps = 3/49 (6%) Frame = -2 Query: 520 QGTRPCTVDNGAIPYPVGGT---QFNRRNQNGMPGKGRPARSSNLPRSS 383 QG P +P+P G Q N G PG+G R SNLP+SS Sbjct: 1138 QGFPPVQSPPQQVPFPHNGPTGGQGNFPGGIGFPGEGPLGRPSNLPQSS 1186 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 96,894,205 Number of Sequences: 219361 Number of extensions: 2076633 Number of successful extensions: 4870 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4717 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4869 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6712189044 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)