| Clone Name | rbasd11m19 |
|---|---|
| Clone Library Name | barley_pub |
>TIM16_BRARE (Q6PBL0) Mitochondrial import inner membrane translocase subunit| TIM16 Length = 129 Score = 38.1 bits (87), Expect = 0.017 Identities = 27/76 (35%), Positives = 38/76 (50%), Gaps = 3/76 (3%) Frame = -1 Query: 407 GRDYTXXXXXXXXXXLFACAVLTTTSYQPC*MQR-YDKLFERN--ATSGSFYLQSKVHRA 237 GR A +L ++ P +Q+ Y+ LF+ N A GSFY+QSKV RA Sbjct: 42 GRQSAAASSFTGMTLQEAQQILNISTLTPEEIQKNYEHLFKVNDKAVGGSFYIQSKVVRA 101 Query: 236 KECLEKVYQKNKQDGT 189 KE L++ N+Q T Sbjct: 102 KERLDEELSINQQQQT 117
>TIM16_KLULA (Q6CK35) Mitochondrial import inner membrane translocase subunit| TIM16 (Presequence translocated-associated motor subunit PAM16) Length = 139 Score = 37.0 bits (84), Expect = 0.037 Identities = 21/55 (38%), Positives = 32/55 (58%), Gaps = 2/55 (3%) Frame = -1 Query: 311 QRYDKLFERN--ATSGSFYLQSKVHRAKECLEKVYQKNKQDGTPT*NSQLLKSAA 153 +R+ LFE N GSFYLQSK++RA E L+ + ++ P N + KS++ Sbjct: 76 ERFKYLFEINDKEKGGSFYLQSKIYRAAERLKYELAEKEKAANPELNQEQAKSSS 130
>TIM16_RAT (Q6EIX2) Mitochondrial import inner membrane translocase subunit| TIM16 (Mitochondria-associated granulocyte macrophage CSF signaling molecule) Length = 124 Score = 37.0 bits (84), Expect = 0.037 Identities = 23/53 (43%), Positives = 31/53 (58%), Gaps = 2/53 (3%) Frame = -1 Query: 347 VLTTTSYQPC*MQRYDKLFERNATS--GSFYLQSKVHRAKECLEKVYQKNKQD 195 +L + P +Q Y+ LF+ N S SFYLQSKV RAKE L++ Q Q+ Sbjct: 62 ILNISKLSPEEVQNYEHLFKVNDKSVGDSFYLQSKVVRAKERLDEELQIQAQE 114
>TIM16_NEUCR (Q7S6S4) Mitochondrial import inner membrane translocase subunit| tim-16 (Presequence translocated-associated motor subunit pam-16) Length = 141 Score = 36.2 bits (82), Expect = 0.063 Identities = 19/33 (57%), Positives = 24/33 (72%), Gaps = 2/33 (6%) Frame = -1 Query: 314 MQRYDKLFERN--ATSGSFYLQSKVHRAKECLE 222 M+R+ +LF+ N GSFYLQSKV RA+E LE Sbjct: 81 MERFKRLFDANDPEKGGSFYLQSKVVRARERLE 113
>TIM16_SCHPO (Q9C1W5) Mitochondrial import inner membrane translocase subunit| tim16 (Presequence translocated-associated motor subunit pam16) Length = 128 Score = 36.2 bits (82), Expect = 0.063 Identities = 20/44 (45%), Positives = 27/44 (61%), Gaps = 2/44 (4%) Frame = -1 Query: 311 QRYDKLFERN--ATSGSFYLQSKVHRAKECLEKVYQKNKQDGTP 186 +R+ K+FE N GSFYLQSKV RA E L+ + Q+ +P Sbjct: 78 KRFQKMFEINDPKKGGSFYLQSKVFRAHEKLKSELDQKIQEQSP 121
>TI16B_XENLA (Q5M995) Mitochondrial import inner membrane translocase subunit| TIM16-B Length = 122 Score = 36.2 bits (82), Expect = 0.063 Identities = 20/44 (45%), Positives = 27/44 (61%), Gaps = 2/44 (4%) Frame = -1 Query: 311 QRYDKLFERN--ATSGSFYLQSKVHRAKECLEKVYQKNKQDGTP 186 + Y+ LF+ N A GSFYLQSKV RAKE L++ + + P Sbjct: 75 KNYEHLFKVNDKAVGGSFYLQSKVVRAKERLDQEMEIQSKTSNP 118
>TIM16_EMENI (Q5B187) Mitochondrial import inner membrane translocase subunit| tim16 (Presequence translocated-associated motor subunit pam16) Length = 135 Score = 35.8 bits (81), Expect = 0.083 Identities = 18/33 (54%), Positives = 24/33 (72%), Gaps = 2/33 (6%) Frame = -1 Query: 314 MQRYDKLFERN--ATSGSFYLQSKVHRAKECLE 222 M+R+ KLF+ N GSFYLQSK+ RA+E +E Sbjct: 75 MERFKKLFDLNDPQKGGSFYLQSKILRARERIE 107
>TIM16_GIBZE (Q4I375) Mitochondrial import inner membrane translocase subunit| TIM16 (Presequence translocated-associated motor subunit PAM16) Length = 138 Score = 35.8 bits (81), Expect = 0.083 Identities = 18/34 (52%), Positives = 23/34 (67%), Gaps = 2/34 (5%) Frame = -1 Query: 314 MQRYDKLFERN--ATSGSFYLQSKVHRAKECLEK 219 + RY +LF+ N GSFYLQSK+ RAKE E+ Sbjct: 79 LSRYKRLFDANDPQKGGSFYLQSKIVRAKERFER 112
>TIM16_DROME (Q9VF08) Mitochondrial import inner membrane translocase subunit| TIM16 (Protein black pearl) Length = 141 Score = 35.4 bits (80), Expect = 0.11 Identities = 19/40 (47%), Positives = 27/40 (67%), Gaps = 2/40 (5%) Frame = -1 Query: 311 QRYDKLFERNATS--GSFYLQSKVHRAKECLEKVYQKNKQ 198 + Y+ LF+ N S GSFY+QSKV RAKE L+ + ++Q Sbjct: 78 KNYEHLFQVNERSKGGSFYIQSKVFRAKERLDHEIKAHEQ 117
>TIM16_CANGA (Q6FT88) Mitochondrial import inner membrane translocase subunit| TIM16 (Presequence translocated-associated motor subunit PAM16) Length = 146 Score = 35.0 bits (79), Expect = 0.14 Identities = 20/41 (48%), Positives = 28/41 (68%), Gaps = 3/41 (7%) Frame = -1 Query: 311 QRYDKLFERN--ATSGSFYLQSKVHRAKECLE-KVYQKNKQ 198 QR+D LF N GSFYLQSK++RA E L+ ++ Q+ K+ Sbjct: 82 QRFDYLFNINDKEKGGSFYLQSKIYRASERLKWELAQREKE 122
>TIM16_MOUSE (Q9CQV1) Mitochondrial import inner membrane translocase subunit| TIM16 (Mitochondria-associated granulocyte macrophage CSF signaling molecule) Length = 125 Score = 34.7 bits (78), Expect = 0.18 Identities = 23/54 (42%), Positives = 33/54 (61%), Gaps = 3/54 (5%) Frame = -1 Query: 347 VLTTTSYQPC*MQR-YDKLFERNATS--GSFYLQSKVHRAKECLEKVYQKNKQD 195 +L + P +Q+ Y+ LF+ N S GSFYLQSKV RAKE L++ + Q+ Sbjct: 62 ILNVSKLSPEEVQKNYEHLFKVNDKSVGGSFYLQSKVVRAKERLDEELRIQAQE 115
>TIM16_HUMAN (Q9Y3D7) Mitochondrial import inner membrane translocase subunit| TIM16 (Mitochondria-associated granulocyte macrophage CSF signaling molecule) Length = 125 Score = 34.7 bits (78), Expect = 0.18 Identities = 23/54 (42%), Positives = 33/54 (61%), Gaps = 3/54 (5%) Frame = -1 Query: 347 VLTTTSYQPC*MQR-YDKLFERNATS--GSFYLQSKVHRAKECLEKVYQKNKQD 195 +L + P +Q+ Y+ LF+ N S GSFYLQSKV RAKE L++ + Q+ Sbjct: 62 ILNVSKLSPEEVQKNYEHLFKVNDKSVGGSFYLQSKVVRAKERLDEELKIQAQE 115
>TIM16_CAEBR (Q60RS2) Mitochondrial import inner membrane translocase subunit| TIM16 Length = 138 Score = 34.7 bits (78), Expect = 0.18 Identities = 18/40 (45%), Positives = 27/40 (67%), Gaps = 2/40 (5%) Frame = -1 Query: 311 QRYDKLFERN--ATSGSFYLQSKVHRAKECLEKVYQKNKQ 198 + Y+ LF N A G+FYLQSKV+RAKE +++ + +Q Sbjct: 84 KHYEHLFAINDKAKGGTFYLQSKVYRAKERIDEELSRLEQ 123
>TI16A_XENLA (Q6NTU3) Mitochondrial import inner membrane translocase subunit| TIM16-A Length = 125 Score = 33.5 bits (75), Expect = 0.41 Identities = 22/51 (43%), Positives = 30/51 (58%), Gaps = 8/51 (15%) Frame = -1 Query: 311 QRYDKLFERN--ATSGSFYLQSKVHRAKECLEKVYQ------KNKQDGTPT 183 + Y+ LF+ N GSFYLQSKV RAKE L++ + K K++ T T Sbjct: 75 KNYEHLFKVNDKGLGGSFYLQSKVVRAKERLDQEMEIQSKTHKPKEETTQT 125
>TIM16_XENTR (Q5XGJ0) Mitochondrial import inner membrane translocase subunit| TIM16 Length = 125 Score = 33.1 bits (74), Expect = 0.54 Identities = 18/33 (54%), Positives = 23/33 (69%), Gaps = 2/33 (6%) Frame = -1 Query: 311 QRYDKLFERN--ATSGSFYLQSKVHRAKECLEK 219 + Y+ LF+ N GSFYLQSKV RAKE L++ Sbjct: 75 KNYEHLFKVNDKEVGGSFYLQSKVVRAKERLDQ 107
>TIM16_YEAST (P42949) Mitochondrial import inner membrane translocase subunit| TIM16 (Presequence translocated-associated motor subunit PAM16) Length = 149 Score = 32.3 bits (72), Expect = 0.92 Identities = 18/31 (58%), Positives = 22/31 (70%), Gaps = 2/31 (6%) Frame = -1 Query: 308 RYDKLFERN--ATSGSFYLQSKVHRAKECLE 222 R++ LFE N GSFYLQSKV+RA E L+ Sbjct: 79 RFNYLFEVNDKEKGGSFYLQSKVYRAAERLK 109
>TIM16_ASHGO (Q754J4) Mitochondrial import inner membrane translocase subunit| TIM16 (Presequence translocated-associated motor subunit PAM16) Length = 136 Score = 32.3 bits (72), Expect = 0.92 Identities = 19/42 (45%), Positives = 28/42 (66%), Gaps = 3/42 (7%) Frame = -1 Query: 311 QRYDKLFERN--ATSGSFYLQSKVHRAKECLE-KVYQKNKQD 195 QR+ LF+ N GSFYLQSK++RA E L+ ++ Q+ + D Sbjct: 79 QRFKYLFDINDKEKGGSFYLQSKIYRAAERLKWELAQREQAD 120
>TIM16_CAEEL (O62250) Mitochondrial import inner membrane translocase subunit| TIM16 Length = 136 Score = 31.2 bits (69), Expect = 2.0 Identities = 19/52 (36%), Positives = 29/52 (55%), Gaps = 9/52 (17%) Frame = -1 Query: 311 QRYDKLFERNATS--GSFYLQSKVHRAKECLEKVY-------QKNKQDGTPT 183 + Y+ LF N S G+ YLQSKV RAKE +++ + +K K++ T Sbjct: 84 KHYEHLFNINDKSKGGTLYLQSKVFRAKERIDEEFGRIELKEEKKKEENAKT 135
>ZAN_MOUSE (O88799) Zonadhesin precursor| Length = 5376 Score = 30.0 bits (66), Expect = 4.5 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = +3 Query: 300 VIPLHSTRLIRGCSQHCTCE 359 +IP + T L RGC+Q CTC+ Sbjct: 4331 LIPANKTWLTRGCAQKCTCK 4350
>T240L_HUMAN (Q71F56) Thyroid hormone receptor-associated protein 2 (Thyroid| hormone receptor-associated protein complex 240 kDa component-like) Length = 2210 Score = 29.6 bits (65), Expect = 5.9 Identities = 25/93 (26%), Positives = 35/93 (37%), Gaps = 2/93 (2%) Frame = -2 Query: 310 SGMTSYSREMRHLGAFTSNPRFTGPRSA*KKCTKRTSKMELRPEIRNF*NQLPRYCNLIF 131 SG S + G+ S P T P ++ + T M+ PE + Y LI Sbjct: 1067 SGQGSVKYDSTDQGSPASTPSTTRPLNSVEPAT-----MQPIPEAHSL------YVTLIL 1115 Query: 130 FPPLERNVHTNN--GCCCCVINKKVKGGDSGLF 38 + N CC C N +KG D GL+ Sbjct: 1116 SDSVMNIFKDRNFDSCCICACNMNIKGADVGLY 1148
>T240L_MOUSE (Q6JPI3) Thyroid hormone receptor-associated protein 2 (Thyroid| hormone receptor-associated protein complex 240 kDa component-like) Length = 2207 Score = 29.6 bits (65), Expect = 5.9 Identities = 25/93 (26%), Positives = 35/93 (37%), Gaps = 2/93 (2%) Frame = -2 Query: 310 SGMTSYSREMRHLGAFTSNPRFTGPRSA*KKCTKRTSKMELRPEIRNF*NQLPRYCNLIF 131 SG S + G+ S P T P ++ + T M+ PE + Y LI Sbjct: 1062 SGQGSVKYDSTDQGSPASTPSTTRPLNSVEPAT-----MQPIPEAHSL------YVTLIL 1110 Query: 130 FPPLERNVHTNN--GCCCCVINKKVKGGDSGLF 38 + N CC C N +KG D GL+ Sbjct: 1111 SDSVMNVFKDRNFDSCCICACNMNIKGADVGLY 1143
>VINT_BPP22 (P04890) Integrase| Length = 387 Score = 29.3 bits (64), Expect = 7.8 Identities = 19/62 (30%), Positives = 28/62 (45%) Frame = -2 Query: 544 AYRKALENANKTGVAHEAINNIRRASKTMTEQEARQILGVTEQSTWEEIIQVFSYLHLAP 365 A+R AL+ A G+ +++R + Q I + E WE I V Y HLAP Sbjct: 298 AWRAALKRA---GIEDFRFHDLRHTWASWLVQAGVPISVLQEMGGWESIEMVRRYAHLAP 354 Query: 364 RY 359 + Sbjct: 355 NH 356
>TIM16_CANAL (Q59ZW9) Mitochondrial import inner membrane translocase subunit| TIM16 (Presequence translocated-associated motor subunit PAM16) Length = 121 Score = 29.3 bits (64), Expect = 7.8 Identities = 15/33 (45%), Positives = 22/33 (66%), Gaps = 2/33 (6%) Frame = -1 Query: 311 QRYDKLFERNATS--GSFYLQSKVHRAKECLEK 219 ++Y+ LF N+ SFYLQSKV+ A + L+K Sbjct: 72 EKYEYLFNVNSKEQGNSFYLQSKVYYAMDTLKK 104
>TR240_HUMAN (Q9UHV7) Thyroid hormone receptor-associated protein complex 240 kDa| component (Trap240) (Thyroid hormone receptor-associated protein 1) (Vitamin D3 receptor-interacting protein complex component DRIP250) (DRIP 250) (Activator-recruited cofac Length = 2174 Score = 29.3 bits (64), Expect = 7.8 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = -2 Query: 100 NNGCCCCVINKKVKGGDSGLF 38 ++ CC CV N +KG D G++ Sbjct: 1090 SDSCCICVCNMNIKGADVGVY 1110
>TIM16_YARLI (Q6C331) Mitochondrial import inner membrane translocase subunit| TIM16 (Presequence translocated-associated motor subunit PAM16) Length = 147 Score = 29.3 bits (64), Expect = 7.8 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -1 Query: 275 SGSFYLQSKVHRAKE 231 SGSFYLQSKV+RA E Sbjct: 106 SGSFYLQSKVYRAME 120 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 78,394,358 Number of Sequences: 219361 Number of extensions: 1651515 Number of successful extensions: 3932 Number of sequences better than 10.0: 25 Number of HSP's better than 10.0 without gapping: 3805 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3928 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4488201198 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)