| Clone Name | rbasd11j18 |
|---|---|
| Clone Library Name | barley_pub |
>RPA9_YEAST (P32529) DNA-directed RNA polymerase I 13.7 kDa polypeptide (EC| 2.7.7.6) (A12.2) Length = 125 Score = 31.2 bits (69), Expect = 2.9 Identities = 13/42 (30%), Positives = 20/42 (47%) Frame = -2 Query: 371 INDVLILKGPCPNCGTENLSFYGTILSIESGGATNNVKCANC 246 + D +K CP CG E ++++ L GAT C +C Sbjct: 76 LKDGATIKEKCPQCGNEEMNYHTLQLRSADEGATVFYTCTSC 117
>SEM5B_HUMAN (Q9P283) Semaphorin-5B precursor| Length = 1093 Score = 31.2 bits (69), Expect = 2.9 Identities = 17/41 (41%), Positives = 24/41 (58%) Frame = +1 Query: 133 LNYQT*KANSPSRCSYLPQN*SGSVISRVFESYTITVLQFA 255 L+ T K N +RC Y P++ S +VIS E Y TV+ F+ Sbjct: 158 LSRTTEKINGVARCPYDPRHNSTAVISSQGELYAATVIDFS 198
>INSL5_PANTR (Q5CZK5) Insulin-like peptide INSL5 precursor (Insulin-like peptide| 5) [Contains: Insulin-like peptide INSL5 B chain; Insulin-like peptide INSL5 A chain] Length = 135 Score = 30.8 bits (68), Expect = 3.8 Identities = 16/37 (43%), Positives = 22/37 (59%), Gaps = 2/37 (5%) Frame = -1 Query: 642 ARWKRHSDGRPQVQSTES-EGLQRPH-R*LLEDVPAE 538 +RW+RH +G PQ Q E+ Q PH R E+ PA+ Sbjct: 44 SRWRRHLEGIPQAQQAETGNSFQLPHKREFSEENPAQ 80
>INSL5_HUMAN (Q9Y5Q6) Insulin-like peptide INSL5 precursor (Insulin-like peptide| 5) [Contains: Insulin-like peptide INSL5 B chain; Insulin-like peptide INSL5 A chain] Length = 135 Score = 30.8 bits (68), Expect = 3.8 Identities = 16/37 (43%), Positives = 22/37 (59%), Gaps = 2/37 (5%) Frame = -1 Query: 642 ARWKRHSDGRPQVQSTES-EGLQRPH-R*LLEDVPAE 538 +RW+RH +G PQ Q E+ Q PH R E+ PA+ Sbjct: 44 SRWRRHLEGIPQAQQAETGNSFQLPHKREFSEENPAQ 80
>RS27_SULSO (Q97Z80) 30S ribosomal protein S27e| Length = 66 Score = 30.4 bits (67), Expect = 4.9 Identities = 16/42 (38%), Positives = 20/42 (47%) Frame = -2 Query: 353 LKGPCPNCGTENLSFYGTILSIESGGATNNVKCANCKTVMVY 228 L+ CPNCG E F AT V+C +C T +VY Sbjct: 17 LRVKCPNCGNEQTIF---------SHATFPVRCLSCGTELVY 49
>MRH4_KLULA (Q6CWQ5) ATP-dependent RNA helicase MRH4, mitochondrial precursor| (EC 3.6.1.-) Length = 584 Score = 30.4 bits (67), Expect = 4.9 Identities = 17/56 (30%), Positives = 25/56 (44%), Gaps = 1/56 (1%) Frame = +1 Query: 328 PQFGQGPFRIKTSFIMALVTTCAVTNIRGKAAKY-VNMKPKGSGNWNTLTSKPVSS 492 P F + P+ K+ FI AV+ G + K + KP+ WNT PV + Sbjct: 3 PVFSRFPYASKSGFISLASRGYAVSRNSGSSIKSNLRSKPRADTRWNTKAKPPVKN 58
>SEM5B_MOUSE (Q60519) Semaphorin-5B precursor (Semaphorin G) (Sema G)| Length = 1093 Score = 30.0 bits (66), Expect = 6.5 Identities = 15/35 (42%), Positives = 21/35 (60%) Frame = +1 Query: 151 KANSPSRCSYLPQN*SGSVISRVFESYTITVLQFA 255 K N +RC Y P++ S +VIS E Y TV+ F+ Sbjct: 164 KINGVARCPYDPRHNSTAVISSQGELYAATVIDFS 198
>NAPA_PSEAE (Q9I4G3) Periplasmic nitrate reductase precursor (EC 1.7.99.4)| Length = 829 Score = 30.0 bits (66), Expect = 6.5 Identities = 15/44 (34%), Positives = 24/44 (54%) Frame = -2 Query: 455 PEPFGFIFTYFAALPLILVTAQVVTKAIINDVLILKGPCPNCGT 324 P PF A LP+++ + +VT+A + ++ K PC CGT Sbjct: 8 PPPFA---AAAAGLPILVRASNLVTEADVTSLVWNKAPCRFCGT 48
>RS27_SULTO (Q973F9) 30S ribosomal protein S27e| Length = 66 Score = 29.6 bits (65), Expect = 8.4 Identities = 15/38 (39%), Positives = 18/38 (47%) Frame = -2 Query: 341 CPNCGTENLSFYGTILSIESGGATNNVKCANCKTVMVY 228 CPNCG E F AT V+C +C T +VY Sbjct: 21 CPNCGNEQTVF---------SHATFPVRCLSCGTQLVY 49
>HXT3_YEAST (P32466) Low-affinity glucose transporter HXT3| Length = 567 Score = 29.6 bits (65), Expect = 8.4 Identities = 17/45 (37%), Positives = 22/45 (48%), Gaps = 1/45 (2%) Frame = -1 Query: 195 LVLWKVGATR-WRVGLSCLVIKQANGIVKSATNCLLLLCCSMIFC 64 +V VG TR W G + NG K A NC+++ C IFC Sbjct: 399 VVYASVGVTRLWPNG-------EGNGSSKGAGNCMIVFACFYIFC 436 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 90,579,764 Number of Sequences: 219361 Number of extensions: 1822699 Number of successful extensions: 4650 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 4497 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4648 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6370891296 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)