| Clone Name | rbasd11j02 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | FLGH_BUCBP (Q89AH6) Flagellar L-ring protein precursor (Basal bo... | 32 | 1.5 | 2 | SECY_BUCBP (Q89A85) Preprotein translocase secY subunit | 30 | 5.8 | 3 | KPTA1_ARCFU (O29841) Probable RNA 2'-phosphotransferase 1 (EC 2.... | 30 | 5.8 | 4 | CHD9_HUMAN (Q3L8U1) Chromodomain-helicase-DNA-binding protein 9 ... | 29 | 7.6 |
|---|
>FLGH_BUCBP (Q89AH6) Flagellar L-ring protein precursor (Basal body L-ring| protein) Length = 244 Score = 31.6 bits (70), Expect = 1.5 Identities = 20/41 (48%), Positives = 25/41 (60%), Gaps = 1/41 (2%) Frame = +1 Query: 55 LLHMYILRNFVSERKNIATNKKQKRSKC-SLPILALSTETN 174 L+ +IL N S KNI NKKQK+ K +LPI S ET+ Sbjct: 15 LILFFILLNGCSIDKNIILNKKQKQHKIFNLPITHTSKETH 55
>SECY_BUCBP (Q89A85) Preprotein translocase secY subunit| Length = 441 Score = 29.6 bits (65), Expect = 5.8 Identities = 13/33 (39%), Positives = 23/33 (69%), Gaps = 1/33 (3%) Frame = -1 Query: 185 VPLTFVS-VDKASIGKLHLLRFCFLLVAIFFLS 90 +P +F++ V+K G LH+L FCF+ + IF ++ Sbjct: 200 LPSSFLNTVEKVRQGSLHVLLFCFIGIVIFLVT 232
>KPTA1_ARCFU (O29841) Probable RNA 2'-phosphotransferase 1 (EC 2.7.-.-)| Length = 216 Score = 29.6 bits (65), Expect = 5.8 Identities = 13/36 (36%), Positives = 18/36 (50%) Frame = +1 Query: 376 HLPHNRGLNTFSKLHFNLRSKRDIVCQRFEWINRWI 483 H P GLN NL S +V +R++W N W+ Sbjct: 46 HFPDKFGLNMDENGWVNLESLARVVKRRYKWANIWL 81
>CHD9_HUMAN (Q3L8U1) Chromodomain-helicase-DNA-binding protein 9 (EC 3.6.1.-)| (ATP-dependent helicase CHD9) (CHD-9) (Chromatin-related mesenchymal modulator) (CReMM) (Chromatin remodeling factor CHROM1) (Peroxisomal proliferator-activated receptor A-inter Length = 2897 Score = 29.3 bits (64), Expect = 7.6 Identities = 22/77 (28%), Positives = 35/77 (45%), Gaps = 2/77 (2%) Frame = +2 Query: 242 KIDQSCDVAEYS--KRSRLDGVDWKMTRSLLVSWYINDHCIAISESFICLTTEA*TRFPS 415 KIDQS D + + +L+G++W LL +WY +CI E + T ++ T Sbjct: 847 KIDQSRDYKNGNQLREYQLEGLNW-----LLFNWYNRRNCILADEMGLGKTIQSITFLYE 901 Query: 416 CTSTSVAKEILFASDLS 466 T + L + LS Sbjct: 902 ILLTGIRGPFLIIAPLS 918 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 80,089,687 Number of Sequences: 219361 Number of extensions: 1616731 Number of successful extensions: 3854 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 3756 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3854 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4373119116 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)