| Clone Name | rbasd11h06 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | Y819_PASMU (Q9CMK4) Hypothetical protein PM0819 | 30 | 1.9 | 2 | UL31_EBV (P03183) Protein BFLF2 | 29 | 2.4 | 3 | NOL11_CHICK (Q5ZL79) Nucleolar protein 11 | 28 | 5.4 | 4 | TOPRS_DROME (Q9V8P9) Ubiquitin-protein E3 ligase Topors (EC 6.3.... | 28 | 7.1 | 5 | POLS_SFV (P03315) Structural polyprotein (p130) [Contains: Capsi... | 27 | 9.3 | 6 | YCED_SALTY (P0A1T2) Hypothetical protein yceD (G30K) | 27 | 9.3 | 7 | YCED_SALTI (P0A1T3) Hypothetical protein yceD | 27 | 9.3 | 8 | MURA_HAEIN (P45025) UDP-N-acetylglucosamine 1-carboxyvinyltransf... | 27 | 9.3 |
|---|
>Y819_PASMU (Q9CMK4) Hypothetical protein PM0819| Length = 172 Score = 29.6 bits (65), Expect = 1.9 Identities = 18/49 (36%), Positives = 27/49 (55%), Gaps = 7/49 (14%) Frame = -3 Query: 367 ALQRRDQDQEQPPLKKRK------TGVLDRQLRSGTTPCLLL-FWLSKS 242 A+QRR D+E+ KR G+LD+ L+ T+P LL +W K+ Sbjct: 83 AIQRRLHDKEKQLAHKRSQQVEDYAGILDKWLKERTSPVYLLWYWQDKN 131
>UL31_EBV (P03183) Protein BFLF2| Length = 318 Score = 29.3 bits (64), Expect = 2.4 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = +3 Query: 42 LRRPHHPHERIYTWSAHKVHTYTHHSLACGEQRAN*GNKRKL 167 LRR HPH R YT S H+ S CG+ R+ G ++ Sbjct: 21 LRRLMHPHHRNYTASKASAHSVKSVS-RCGKSRSELGRMERV 61
>NOL11_CHICK (Q5ZL79) Nucleolar protein 11| Length = 723 Score = 28.1 bits (61), Expect = 5.4 Identities = 13/47 (27%), Positives = 23/47 (48%) Frame = -1 Query: 288 DLGRRHVCCSFGYLNPAYVRCCPRLHVVSPKLSSTTILVLVTFFCYL 148 DL + YL+ YV+C +++ P + S TI ++ + C L Sbjct: 612 DLPAQQAVLFLRYLHYLYVKCSEKINTTLPGILSPTISQIMDWMCLL 658
>TOPRS_DROME (Q9V8P9) Ubiquitin-protein E3 ligase Topors (EC 6.3.2.-)| (SUMO1-protein E3 ligase Topors) (Topoisomerase I-binding RING finger protein) (Topoisomerase I-binding arginine/serine-rich protein) (dTopors) Length = 1038 Score = 27.7 bits (60), Expect = 7.1 Identities = 10/32 (31%), Positives = 18/32 (56%) Frame = -1 Query: 156 CYLSLLFARRMLASDGCMCVLCVRSMCKFSRV 61 C + L RR +D CM C + +C++S++ Sbjct: 102 CAICLSRCRRKCFTDSCMHQFCFKCLCEWSKI 133
>POLS_SFV (P03315) Structural polyprotein (p130) [Contains: Capsid protein (EC| 3.4.21.-) (Coat protein) (C); p62 (E3/E2); E3 protein (Spike glycoprotein E3); E2 envelope glycoprotein (Spike glycoprotein E2); 6K protein; E1 envelope glycoprotein (Spike gly Length = 1253 Score = 27.3 bits (59), Expect = 9.3 Identities = 17/49 (34%), Positives = 25/49 (51%), Gaps = 8/49 (16%) Frame = +2 Query: 95 STHIHPSLASMRRAKSKLR*QKKVT--------STSIVVLLSLGETTCS 217 S H H ++A+++ A +K++ KVT S S VV L TCS Sbjct: 1144 SVHSHSNVATLQEATAKVKTAGKVTLHFSTASASPSFVVSLCSARATCS 1192
>YCED_SALTY (P0A1T2) Hypothetical protein yceD (G30K)| Length = 173 Score = 27.3 bits (59), Expect = 9.3 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +1 Query: 67 REFTHGAHTKYTHTPITR*HAASKEQTEVTKESYK 171 + FTH HT Y +P+ S EQ E E+Y+ Sbjct: 78 KPFTHQVHTTYCFSPV-----RSDEQAEALPEAYE 107
>YCED_SALTI (P0A1T3) Hypothetical protein yceD| Length = 173 Score = 27.3 bits (59), Expect = 9.3 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +1 Query: 67 REFTHGAHTKYTHTPITR*HAASKEQTEVTKESYK 171 + FTH HT Y +P+ S EQ E E+Y+ Sbjct: 78 KPFTHQVHTTYCFSPV-----RSDEQAEALPEAYE 107
>MURA_HAEIN (P45025) UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC| 2.5.1.7) (Enoylpyruvate transferase) (UDP-N-acetylglucosamine enolpyruvyl transferase) (EPT) Length = 424 Score = 27.3 bits (59), Expect = 9.3 Identities = 12/45 (26%), Positives = 22/45 (48%) Frame = +3 Query: 204 KLHAASDSNVRTQDLDNQKSSKHGVVPDRSCRSSTPVFLFFSGGC 338 K+ A +++ + ++ +H VVPDR + + SGGC Sbjct: 206 KITGAGSAHITIEGVERLTGCEHSVVPDRIETGTFLIAAAISGGC 250 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 49,099,561 Number of Sequences: 219361 Number of extensions: 876923 Number of successful extensions: 2393 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 2325 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2391 length of database: 80,573,946 effective HSP length: 99 effective length of database: 58,857,207 effective search space used: 1412572968 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)