| Clone Name | rbasd11f22 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | LRC32_PONPY (Q5RF01) Leucine-rich repeat-containing protein 32 p... | 32 | 0.83 | 2 | LRC32_HUMAN (Q14392) Leucine-rich repeat-containing protein 32 p... | 31 | 2.4 | 3 | PARA_ECOLI (P07620) Plasmid partition protein A | 30 | 5.4 | 4 | PSD6_ARATH (Q93Y35) Probable 26S proteasome non-ATPase regulator... | 29 | 7.1 | 5 | SFR11_HUMAN (Q05519) Splicing factor arginine/serine-rich 11 (Ar... | 29 | 7.1 |
|---|
>LRC32_PONPY (Q5RF01) Leucine-rich repeat-containing protein 32 precursor| Length = 662 Score = 32.3 bits (72), Expect = 0.83 Identities = 24/66 (36%), Positives = 30/66 (45%) Frame = +1 Query: 37 WLSLFCKYINWLHF*DFAGLPNIIYSVRSEQSLLLPTGRLHCKTQKASGVLQSSSGETTA 216 WL L + LHF D A LP +IY S + LPTG Q + G+ S G + Sbjct: 247 WLDL--RENKLLHFPDLAALPRLIYLNLSNNLIRLPTG----PPQDSKGIHAPSEGWSAL 300 Query: 217 GRSTRS 234 ST S Sbjct: 301 PLSTPS 306
>LRC32_HUMAN (Q14392) Leucine-rich repeat-containing protein 32 precursor (GARP| protein) (Garpin) (Glycoprotein A repetitions predominant) Length = 662 Score = 30.8 bits (68), Expect = 2.4 Identities = 21/56 (37%), Positives = 26/56 (46%) Frame = +1 Query: 37 WLSLFCKYINWLHF*DFAGLPNIIYSVRSEQSLLLPTGRLHCKTQKASGVLQSSSG 204 WL L + LHF D A LP +IY S + LPTG Q + G+ S G Sbjct: 247 WLDL--RENKLLHFPDLAALPRLIYLNLSNNLIRLPTG----PPQDSKGIHAPSEG 296
>PARA_ECOLI (P07620) Plasmid partition protein A| Length = 398 Score = 29.6 bits (65), Expect = 5.4 Identities = 13/29 (44%), Positives = 20/29 (68%) Frame = +2 Query: 2 KLLQELKXI*SCGCRCSASTSIGFISKIS 88 +L + +K I GC C +T+IGF+SK+S Sbjct: 290 RLPELVKLISDEGCECQLATNIGFMSKLS 318
>PSD6_ARATH (Q93Y35) Probable 26S proteasome non-ATPase regulatory subunit 6| Length = 387 Score = 29.3 bits (64), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 115 VRSEQSLLLPTGRLHCKTQKASGVLQSS 198 + E S + G+LHCK K +GVL+++ Sbjct: 328 IDQELSRFIAAGKLHCKIDKVAGVLETN 355
>SFR11_HUMAN (Q05519) Splicing factor arginine/serine-rich 11 (Arginine-rich 54| kDa nuclear protein) (p54) Length = 484 Score = 29.3 bits (64), Expect = 7.1 Identities = 16/45 (35%), Positives = 24/45 (53%) Frame = -1 Query: 442 TR*GTSSVR*PRAPKNPLHR*QDLPAQQRPKQKEKQKTRGPAPRD 308 +R GT S + PR+PK L R ++ K+K+K K R R+ Sbjct: 348 SRSGTRSPKKPRSPKRKLSRSPSPRRHKKEKKKDKDKERSRDERE 392 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 62,979,270 Number of Sequences: 219361 Number of extensions: 1100236 Number of successful extensions: 3492 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 3258 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3490 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4085413911 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)