| Clone Name | rbasd11d24 |
|---|---|
| Clone Library Name | barley_pub |
>UPTG_PEA (O04300) Alpha-1,4-glucan-protein synthase [UDP-forming] (EC| 2.4.1.112) (UDP-glucose:protein transglucosylase) (UPTG) (Reversibly glycosylated polypeptide) Length = 364 Score = 37.0 bits (84), Expect = 0.012 Identities = 17/49 (34%), Positives = 26/49 (53%) Frame = -1 Query: 361 FESLKLSRTAVTVDDCIKELAGIVRQKLAPKNAIFSKXXDAMEEWTKLW 215 F++ LS+ +V C EL+ V++KL + F K DAM W + W Sbjct: 293 FQAATLSKDCTSVQKCYIELSKQVKEKLGTIDPYFIKLADAMVTWVEAW 341
>UPTG2_SOLTU (Q8RU27) Alpha-1,4-glucan-protein synthase [UDP-forming] 2 (EC| 2.4.1.112) (UDP-glucose:protein transglucosylase 2) (UPTG 2) Length = 366 Score = 35.8 bits (81), Expect = 0.026 Identities = 16/48 (33%), Positives = 26/48 (54%) Frame = -1 Query: 358 ESLKLSRTAVTVDDCIKELAGIVRQKLAPKNAIFSKXXDAMEEWTKLW 215 +S L + +V C EL+ V++KL+ + F+K DAM W + W Sbjct: 295 QSATLPKDCTSVQQCYLELSKQVKEKLSTIDPYFTKLADAMVTWIEAW 342
>Y924_DESVH (Q72DK5) Hypothetical RNA methyltransferase DVU0924 (EC 2.1.1.-)| Length = 468 Score = 28.1 bits (61), Expect = 5.5 Identities = 14/34 (41%), Positives = 17/34 (50%), Gaps = 4/34 (11%) Frame = +1 Query: 208 EISRAWSIPPW----HRXXWRRLHSSAPASASQC 297 +I+RA +P W HR WR L PA QC Sbjct: 178 DIARASGLPGWDDAAHRGFWRFLVVREPARGGQC 211
>RFCL_NATPD (Q3ISA5) Replication factor C large subunit (RFC large subunit)| (Clamp loader large subunit) Length = 483 Score = 27.7 bits (60), Expect = 7.2 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -1 Query: 256 SKXXDAMEEWTKLWKSH 206 +K DA EEW K W+ H Sbjct: 20 NKARDAFEEWAKAWEDH 36
>CO3_NAJNA (Q01833) Cobra venom factor precursor (CVF) (Complement C3 homolog)| [Contains: Cobra venom factor alpha chain; Cobra venom factor gamma chain; Cobra venom factor beta chain] Length = 1651 Score = 27.7 bits (60), Expect = 7.2 Identities = 9/30 (30%), Positives = 20/30 (66%) Frame = +3 Query: 12 VLESYTNRTPGSLNVYIHKFPSHGNTXYSA 101 ++E++ + TP SL++++H FP T + + Sbjct: 42 LVEAHGDSTPKSLDIFVHDFPRKQKTLFQS 71
>PRMA_BORPA (Q7W3W2) Ribosomal protein L11 methyltransferase (EC 2.1.1.-) (L11| Mtase) Length = 307 Score = 27.7 bits (60), Expect = 7.2 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = +1 Query: 163 WIKWTQSSIRRSELHEISRAWSIPPWHR 246 W++ TQS + E R W +P WHR Sbjct: 102 WVRLTQSQFGPIPISE--RLWIVPSWHR 127
>PRMA_BORBR (Q7WF92) Ribosomal protein L11 methyltransferase (EC 2.1.1.-) (L11| Mtase) Length = 307 Score = 27.7 bits (60), Expect = 7.2 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = +1 Query: 163 WIKWTQSSIRRSELHEISRAWSIPPWHR 246 W++ TQS + E R W +P WHR Sbjct: 102 WVRLTQSQFGPIPISE--RLWIVPSWHR 127
>CHS1_RHIOL (P30594) Chitin synthase 1 (EC 2.4.1.16) (Chitin-UDP| acetyl-glucosaminyl transferase 1) Length = 858 Score = 24.6 bits (52), Expect(2) = 8.7 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -3 Query: 206 WSSERLILDCVHFIHQDTY 150 WSS IL C+ F+ +D Y Sbjct: 517 WSSNHNILRCIMFMFEDLY 535 Score = 21.2 bits (43), Expect(2) = 8.7 Identities = 9/33 (27%), Positives = 16/33 (48%) Frame = -1 Query: 304 LAGIVRQKLAPKNAIFSKXXDAMEEWTKLWKSH 206 +A + Q+ N F +M W+K+W S+ Sbjct: 488 VAEFISQRRRWLNGSFFAGIYSMVHWSKVWSSN 520 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 47,829,572 Number of Sequences: 219361 Number of extensions: 810188 Number of successful extensions: 1718 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 1706 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1718 length of database: 80,573,946 effective HSP length: 95 effective length of database: 59,734,651 effective search space used: 1433631624 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)