| Clone Name | bags9j07 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | AVRC_PSESG (P13836) Avirulence C protein | 33 | 0.57 | 2 | SYFA_CLOAB (Q97GK9) Phenylalanyl-tRNA synthetase alpha chain (EC... | 30 | 2.8 | 3 | VGLB_GPCMV (Q69024) Glycoprotein B precursor | 29 | 6.3 | 4 | SYFA_CLOTE (Q891T7) Phenylalanyl-tRNA synthetase alpha chain (EC... | 29 | 6.3 | 5 | SRD46_CAEEL (Q19508) Serpentine receptor class delta-46 (Protein... | 29 | 8.2 | 6 | ALG12_DROME (Q9VH78) Probable dolichyl-P-Man:Man(7)GlcNAc(2)-PP-... | 29 | 8.2 |
|---|
>AVRC_PSESG (P13836) Avirulence C protein| Length = 352 Score = 32.7 bits (73), Expect = 0.57 Identities = 18/43 (41%), Positives = 22/43 (51%) Frame = +1 Query: 373 DDRTGENIRRKPN*DENKLTCEYIY*NYRLLGQVVAFGFQMNF 501 DD G NI K N ENK CE +Y R+ G +A G +F Sbjct: 78 DDAPGLNISNKSNTQENKRYCESLYQAARIAGGSIASGRVTSF 120
>SYFA_CLOAB (Q97GK9) Phenylalanyl-tRNA synthetase alpha chain (EC 6.1.1.20)| (Phenylalanine--tRNA ligase alpha chain) (PheRS) Length = 339 Score = 30.4 bits (67), Expect = 2.8 Identities = 17/49 (34%), Positives = 25/49 (51%), Gaps = 3/49 (6%) Frame = +3 Query: 204 NDTLSILLNLMFLAISCQSVA*DTLNFQMQNVPENH---SEQDDFKFSD 341 N +I ++ F+ V D NF+M N+P+NH EQD F +D Sbjct: 115 NKVENIFRDMGFVIEEGPEVEYDKYNFEMLNIPKNHPARGEQDTFYIND 163
>VGLB_GPCMV (Q69024) Glycoprotein B precursor| Length = 901 Score = 29.3 bits (64), Expect = 6.3 Identities = 18/59 (30%), Positives = 28/59 (47%), Gaps = 1/59 (1%) Frame = +3 Query: 144 RPKKGITHSGIISTFWGGKKNDTLSILLNLMFLAISCQSVA*DTLNFQMQNVPE-NHSE 317 RP +GI S I+S W G T + L +++L + C+S + V NHS+ Sbjct: 2 RPVRGIARSRILSCSWRG----TWTSALTILYLGVYCESTTVTPTTVEDTTVSNGNHSD 56
>SYFA_CLOTE (Q891T7) Phenylalanyl-tRNA synthetase alpha chain (EC 6.1.1.20)| (Phenylalanine--tRNA ligase alpha chain) (PheRS) Length = 339 Score = 29.3 bits (64), Expect = 6.3 Identities = 15/44 (34%), Positives = 22/44 (50%), Gaps = 3/44 (6%) Frame = +3 Query: 219 ILLNLMFLAISCQSVA*DTLNFQMQNVPENH---SEQDDFKFSD 341 I +N+ F + D NF+ N+P+NH EQD F +D Sbjct: 120 IFINMGFTVEEGPEIELDYYNFEALNIPKNHPARGEQDTFYIND 163
>SRD46_CAEEL (Q19508) Serpentine receptor class delta-46 (Protein srd-46)| Length = 317 Score = 28.9 bits (63), Expect = 8.2 Identities = 17/49 (34%), Positives = 28/49 (57%), Gaps = 2/49 (4%) Frame = -1 Query: 447 IYIFTSQF--VFILIWFPPDVFSGPVVLFAVIFWNILHLKI*SRLVRCD 307 ++IF S F +F LI FP + ++L+ +IF + HLK R+ C+ Sbjct: 2 LHIFLSYFYIIFFLIVFPTQL----LLLYVIIFHSPKHLKTLKRIFLCN 46
>ALG12_DROME (Q9VH78) Probable| dolichyl-P-Man:Man(7)GlcNAc(2)-PP-dolichyl-alpha-1, 6-mannosyltransferase (EC 2.4.1.-) (Mannosyltransferase ALG12 homolog) Length = 678 Score = 28.9 bits (63), Expect = 8.2 Identities = 12/33 (36%), Positives = 21/33 (63%) Frame = -1 Query: 450 SIYIFTSQFVFILIWFPPDVFSGPVVLFAVIFW 352 +I I F+F + P++F+ P+VLFA+ +W Sbjct: 120 AITITQFHFMFYMTRPLPNIFALPIVLFAIAYW 152 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 73,028,149 Number of Sequences: 219361 Number of extensions: 1385737 Number of successful extensions: 3100 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2955 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3098 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3638905326 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)