| Clone Name | bags8o18 |
|---|---|
| Clone Library Name | barley_pub |
>FA5_PIG (Q9GLP1) Coagulation factor V precursor (Activated protein C| cofactor) [Contains: Coagulation factor V heavy chain; Coagulation factor V light chain] Length = 2258 Score = 33.9 bits (76), Expect = 0.36 Identities = 21/47 (44%), Positives = 27/47 (57%), Gaps = 2/47 (4%) Frame = +1 Query: 298 PASERAY-WSKPVRENS*ATHHSFPCLGHIRYSYWHL-QAVNGHLVG 432 P E Y W+ + E+S TH+ PCL HI YSY +L Q N L+G Sbjct: 144 PGQEYTYEWN--ISEDSGPTHNDPPCLTHIYYSYENLIQDFNSGLIG 188
>NTCP2_CRIGR (Q60414) Ileal sodium/bile acid cotransporter (Ileal Na(+)/bile| acid cotransporter) (Na(+)-dependent ileal bile acid transporter) (Ileal sodium-dependent bile acid transporter) (ISBT) (IBAT) (Apical sodium-dependent bile acid transporter) (AS Length = 348 Score = 32.7 bits (73), Expect = 0.81 Identities = 12/27 (44%), Positives = 19/27 (70%) Frame = +2 Query: 515 LRNPWTVGVGFLAQYLIKPMLGYAIAL 595 LR PW + VGFL Q+ I P+ G+ +++ Sbjct: 62 LRRPWGIVVGFLCQFGIMPLTGFVLSV 88
>APOB_HUMAN (P04114) Apolipoprotein B-100 precursor (Apo B-100) [Contains:| Apolipoprotein B-48 (Apo B-48)] Length = 4563 Score = 32.7 bits (73), Expect = 0.81 Identities = 21/66 (31%), Positives = 33/66 (50%), Gaps = 1/66 (1%) Frame = -1 Query: 346 NYFLVLACSSRPARWQVTRNVS-FCLAENLTAPDNRNKSGRRCGRNGQSPLGLLRGSTSI 170 NY L L+ S++ A WQV+ + + +N +A +N N G NG++ L L +I Sbjct: 3073 NYALFLSPSAQQASWQVSARFNQYKYNQNFSAGNNENIMEAHVGINGEANLDFLNIPLTI 3132 Query: 169 CRHRAP 152 R P Sbjct: 3133 PEMRLP 3138
>NTCP2_RABIT (Q28727) Ileal sodium/bile acid cotransporter (Ileal Na(+)/bile| acid cotransporter) (Na(+) dependent ileal bile acid transporter) (Ileal sodium-dependent bile acid transporter) (ISBT) (IBAT) (Apical sodium dependent bile acid transporter) (AS Length = 347 Score = 32.7 bits (73), Expect = 0.81 Identities = 11/27 (40%), Positives = 19/27 (70%) Frame = +2 Query: 515 LRNPWTVGVGFLAQYLIKPMLGYAIAL 595 +R PW + +GFL Q+ I P+ G+ +A+ Sbjct: 63 IRRPWGIFIGFLCQFGIMPLTGFVLAV 89
>FA5_BOVIN (Q28107) Coagulation factor V precursor (Activated protein C| cofactor) [Contains: Coagulation factor V heavy chain; Coagulation factor V light chain] Length = 2211 Score = 30.8 bits (68), Expect = 3.1 Identities = 20/47 (42%), Positives = 25/47 (53%), Gaps = 2/47 (4%) Frame = +1 Query: 298 PASERAY-WSKPVRENS*ATHHSFPCLGHIRYSYWHL-QAVNGHLVG 432 P E Y W + E+S TH PCL HI YSY +L + N L+G Sbjct: 144 PGQEYTYEWI--ISEHSGPTHDDPPCLTHIYYSYVNLVEDFNSGLIG 188
>FA5_HUMAN (P12259) Coagulation factor V precursor (Activated protein C| cofactor) [Contains: Coagulation factor V heavy chain; Coagulation factor V light chain] Length = 2224 Score = 30.8 bits (68), Expect = 3.1 Identities = 20/47 (42%), Positives = 26/47 (55%), Gaps = 2/47 (4%) Frame = +1 Query: 298 PASERAY-WSKPVRENS*ATHHSFPCLGHIRYSYWHL-QAVNGHLVG 432 P E Y WS + E+S TH PCL HI YS+ +L + N L+G Sbjct: 144 PGREYTYEWS--ISEDSGPTHDDPPCLTHIYYSHENLIEDFNSGLIG 188
>NTCP2_RAT (Q62633) Ileal sodium/bile acid cotransporter (Ileal Na(+)/bile| acid cotransporter) (Na(+)-dependent ileal bile acid transporter) (Ileal sodium-dependent bile acid transporter) (ISBT) (IBAT) (Apical sodium-dependent bile acid transporter) (ASBT Length = 348 Score = 30.4 bits (67), Expect = 4.0 Identities = 10/27 (37%), Positives = 19/27 (70%) Frame = +2 Query: 515 LRNPWTVGVGFLAQYLIKPMLGYAIAL 595 ++ PW + VGFL Q+ I P+ G+ +++ Sbjct: 62 IKRPWGIFVGFLCQFGIMPLTGFILSV 88
>NTCP2_MOUSE (P70172) Ileal sodium/bile acid cotransporter (Ileal Na(+)/bile| acid cotransporter) (Na(+)-dependent ileal bile acid transporter) (Ileal sodium-dependent bile acid transporter) (ISBT) (IBAT) (Apical sodium-dependent bile acid transporter) (AS Length = 348 Score = 30.4 bits (67), Expect = 4.0 Identities = 10/27 (37%), Positives = 19/27 (70%) Frame = +2 Query: 515 LRNPWTVGVGFLAQYLIKPMLGYAIAL 595 ++ PW + VGFL Q+ I P+ G+ +++ Sbjct: 62 IKRPWGIFVGFLCQFGIMPLTGFILSV 88
>NTCP2_HUMAN (Q12908) Ileal sodium/bile acid cotransporter (Ileal Na(+)/bile| acid cotransporter) (Na(+)-dependent ileal bile acid transporter) (Ileal sodium-dependent bile acid transporter) (ISBT) (IBAT) (Apical sodium-dependent bile acid transporter) (AS Length = 348 Score = 30.4 bits (67), Expect = 4.0 Identities = 10/27 (37%), Positives = 19/27 (70%) Frame = +2 Query: 515 LRNPWTVGVGFLAQYLIKPMLGYAIAL 595 ++ PW + VGFL Q+ I P+ G+ +++ Sbjct: 62 IKRPWGICVGFLCQFGIMPLTGFILSV 88
>MATK_CICAR (Q5YK05) Maturase K (Intron maturase)| Length = 509 Score = 29.6 bits (65), Expect = 6.9 Identities = 15/67 (22%), Positives = 34/67 (50%) Frame = -2 Query: 531 VHGFLKHLLKSSNVNVSPIDSIRNPRPRVKRSVSNQVTIDGL*MPITVPNMTQTGKRVVS 352 V + + + +++ +S DS +NP ++ ++Q+ +G + + +P Q+G + Sbjct: 57 VKRLISRMYQQNHLIISANDSNKNPFWGYNKNFNSQIISEGFAIVVEIPFFLQSGSSLKE 116 Query: 351 SSTIFSY 331 S I SY Sbjct: 117 SEIIKSY 123
>K1543_HUMAN (Q9P1Y5) Protein KIAA1543| Length = 1249 Score = 29.3 bits (64), Expect = 9.0 Identities = 24/63 (38%), Positives = 28/63 (44%), Gaps = 6/63 (9%) Frame = +3 Query: 12 LRXSTRYLCQAWRLPRPALSTPWHPSP--ALSARGRASPLL----VSDAD*ELGALCRHM 173 L S C+AWR P L TP +PS AL AR P L V +AD RH Sbjct: 77 LLLSAELYCRAWRQALPQLETPPNPSALLALLARRGTVPALPERPVREAD------LRHQ 130 Query: 174 EVL 182 +L Sbjct: 131 PIL 133
>MCP_HUMAN (P15529) Membrane cofactor protein precursor (Trophoblast leukocyte| common antigen) (TLX) (CD46 antigen) Length = 392 Score = 29.3 bits (64), Expect = 9.0 Identities = 15/39 (38%), Positives = 19/39 (48%) Frame = -2 Query: 543 PTPTVHGFLKHLLKSSNVNVSPIDSIRNPRPRVKRSVSN 427 P+ T L H + +S+ SP S PRP K VSN Sbjct: 289 PSSTKPPALSHSVSTSSTTKSPASSASGPRPTYKPPVSN 327 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 86,873,489 Number of Sequences: 219361 Number of extensions: 1734716 Number of successful extensions: 4940 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 4720 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4935 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5196311029 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)