| Clone Name | bags8n04 |
|---|---|
| Clone Library Name | barley_pub |
>SEC16_SCHPO (O14029) Multidomain vesicle coat protein| Length = 1995 Score = 30.4 bits (67), Expect = 3.1 Identities = 17/40 (42%), Positives = 22/40 (55%) Frame = -1 Query: 471 PPPVFLAEIS*HIPPASPPTNAPFASLPHALSPTAALAFS 352 PPP +A +P A PP+ AP ++LP A P A A S Sbjct: 1883 PPPPPMA-----LPKAGPPSAAPTSALPPAGPPAGATAIS 1917
>NRX3A_HUMAN (Q9Y4C0) Neurexin-3-alpha precursor (Neurexin III-alpha)| Length = 1541 Score = 29.6 bits (65), Expect = 5.3 Identities = 13/25 (52%), Positives = 19/25 (76%) Frame = +3 Query: 30 LKDVEFREQPARVDLSRLAEIADTE 104 LK+V ++ R++LSRLA IADT+ Sbjct: 405 LKEVVYKNNDIRLELSRLARIADTK 429
>CBIL_METJA (Q58181) Probable cobalt-precorrin-2 C(20)-methyltransferase (EC| 2.1.1.151) (S-adenosyl-L-methionine--cobalt-precorrin-2 methyltransferase) Length = 230 Score = 29.6 bits (65), Expect = 5.3 Identities = 13/31 (41%), Positives = 21/31 (67%) Frame = +1 Query: 274 VRDKRLMTLLMTRILKKMQSMTVPPTGKGER 366 V DK+L+TL +LKK+ + VP + KG++ Sbjct: 15 VGDKKLLTLKALEVLKKVDKIFVPVSKKGKK 45
>TILS_THET8 (Q5SI38) tRNA(Ile)-lysidine synthase (EC 6.3.4.-)| (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) Length = 507 Score = 28.9 bits (63), Expect = 9.0 Identities = 22/57 (38%), Positives = 30/57 (52%) Frame = +3 Query: 354 KRRALRSEKAHGVSLQRERSLEEKLGEYVKKFQLETLAGGILCHVKTGRLFLAPDSP 524 +RRALR + L+ E L L E ++ + +TL GG+L K G LFL P P Sbjct: 254 RRRALR-RLLEKLGLRPEARLVLLLEEALRG-RPQTLPGGVLARRKGGTLFLLPPRP 308
>TILS_THET2 (Q72IF6) tRNA(Ile)-lysidine synthase (EC 6.3.4.-)| (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) Length = 507 Score = 28.9 bits (63), Expect = 9.0 Identities = 22/57 (38%), Positives = 30/57 (52%) Frame = +3 Query: 354 KRRALRSEKAHGVSLQRERSLEEKLGEYVKKFQLETLAGGILCHVKTGRLFLAPDSP 524 +RRALR + L+ E L L E ++ + +TL GG+L K G LFL P P Sbjct: 254 RRRALR-RLLEKLGLRPEARLVLLLEEALRG-RPQTLPGGVLARRKGGTLFLLPPRP 308
>PCX1_MOUSE (Q9QYC1) Pecanex-like protein 1 (Pecanex homolog) (Fragment)| Length = 1460 Score = 28.9 bits (63), Expect = 9.0 Identities = 15/35 (42%), Positives = 18/35 (51%) Frame = +2 Query: 380 SAWGKLAKGAFVGGEAGGICQEISARNTGGGNSLP 484 S W +L KG G +GG I +TGGG S P Sbjct: 1147 STWHRLRKGCGAGCNSGG---NIEDSDTGGGTSCP 1178 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 68,948,994 Number of Sequences: 219361 Number of extensions: 1282544 Number of successful extensions: 3901 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 3689 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3897 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 3970331829 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)