| Clone Name | bags8k08 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | MURC_ENTFA (Q833N6) UDP-N-acetylmuramate--L-alanine ligase (EC 6... | 30 | 2.0 | 2 | SYI_TETTH (P36422) Isoleucyl-tRNA synthetase (EC 6.1.1.5) (Isole... | 29 | 4.5 |
|---|
>MURC_ENTFA (Q833N6) UDP-N-acetylmuramate--L-alanine ligase (EC 6.3.2.8)| (UDP-N-acetylmuramoyl-L-alanine synthetase) Length = 445 Score = 30.4 bits (67), Expect = 2.0 Identities = 12/45 (26%), Positives = 25/45 (55%) Frame = +2 Query: 143 YFRSMKSDNPSFYYAIQLDENDKAANVFWADARSIFDYHYFSDVI 277 Y R ++S+ P +YY + +++ +A N+ S FD ++ D + Sbjct: 213 YLRQLESEVPVYYYGVSEEDDIQARNIQRTTEGSSFDVYHKDDFV 257
>SYI_TETTH (P36422) Isoleucyl-tRNA synthetase (EC 6.1.1.5) (Isoleucine--tRNA| ligase) (IleRS) Length = 1081 Score = 29.3 bits (64), Expect = 4.5 Identities = 16/52 (30%), Positives = 25/52 (48%) Frame = -1 Query: 174 DGLSLFILRK*SVRALKSSAFISFVDLVRR*XLVPWRNAYGISIXQIEPWTI 19 D + L+++ VRA + S V V++ +PW NAY I I W + Sbjct: 628 DAIRLYMINSPLVRAEEMSFKSEGVFAVKKDIFLPWYNAYKFLIQSITRWEL 679 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 60,613,070 Number of Sequences: 219361 Number of extensions: 1138146 Number of successful extensions: 2823 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2780 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2822 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2618960580 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)