| Clone Name | bags8e24 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ZN670_HUMAN (Q9BS34) Zinc finger protein 670 | 32 | 1.7 | 2 | CEL_BOVIN (P30122) Bile-salt-activated lipase precursor (EC 3.1.... | 30 | 3.9 | 3 | TS1R1_RAT (Q9Z0R8) Taste receptor type 1 member 1 precursor (G-p... | 30 | 6.6 | 4 | TS1R1_MOUSE (Q99PG6) Taste receptor type 1 member 1 precursor (G... | 30 | 6.6 | 5 | PCX_DROME (P18490) Protein pecanex | 30 | 6.6 |
|---|
>ZN670_HUMAN (Q9BS34) Zinc finger protein 670| Length = 389 Score = 31.6 bits (70), Expect = 1.7 Identities = 30/100 (30%), Positives = 42/100 (42%), Gaps = 3/100 (3%) Frame = -1 Query: 500 GEPVSCHSAQHRSWSPGFRIEHHFKHQNL*LDSLFLCRHKKTNLLHGEQ-GKFRMQLTCR 324 G+ CHSA HR H H + LF C L H +Q GK + LT Sbjct: 109 GKVFICHSALHR---------HILSHIG---NKLFECEECPEKLYHCKQCGKAFISLTSV 156 Query: 323 SSWKMTVLSS--LKNPQGDKPHAMKTLMKMVPSTYHPEQS 210 +T S+ K P +KP ++ +M STY E++ Sbjct: 157 DRHMVTHTSNGPYKGPVYEKPFDFPSVFQMPQSTYTGEKT 196
>CEL_BOVIN (P30122) Bile-salt-activated lipase precursor (EC 3.1.1.3) (EC| 3.1.1.13) (BAL) (Bile-salt-stimulated lipase) (BSSL) (Carboxyl ester lipase) (Sterol esterase) (Cholesterol esterase) (Pancreatic lysophospholipase) (Fragment) Length = 597 Score = 30.4 bits (67), Expect = 3.9 Identities = 16/51 (31%), Positives = 26/51 (50%) Frame = -1 Query: 518 TRWRRTGEPVSCHSAQHRSWSPGFRIEHHFKHQNL*LDSLFLCRHKKTNLL 366 T + RTG+P + HS +W P + ++ N +DS + H +TN L Sbjct: 487 TNFARTGDPNTGHSTVPANWDPYTLEDDNYLEINKQMDSNSMKLHLRTNYL 537
>TS1R1_RAT (Q9Z0R8) Taste receptor type 1 member 1 precursor (G-protein| coupled receptor 70) Length = 840 Score = 29.6 bits (65), Expect = 6.6 Identities = 17/48 (35%), Positives = 24/48 (50%), Gaps = 1/48 (2%) Frame = -1 Query: 143 TIWNLWS-NAGGGSFVKISRQTFLLLLLXWMEERCPHPKAHVATRKHQ 3 T + W+ N G G FV +S LL+ L W+ P P TR++Q Sbjct: 667 TFYRTWAQNHGAGLFVIVSSTVHLLICLTWLVMWTPRP-----TREYQ 709
>TS1R1_MOUSE (Q99PG6) Taste receptor type 1 member 1 precursor (G-protein| coupled receptor 70) Length = 842 Score = 29.6 bits (65), Expect = 6.6 Identities = 17/48 (35%), Positives = 24/48 (50%), Gaps = 1/48 (2%) Frame = -1 Query: 143 TIWNLWS-NAGGGSFVKISRQTFLLLLLXWMEERCPHPKAHVATRKHQ 3 T ++ W+ N G G FV +S L L L W+ P P TR++Q Sbjct: 669 TFYHTWAQNHGAGIFVIVSSTVHLFLCLTWLAMWTPRP-----TREYQ 711
>PCX_DROME (P18490) Protein pecanex| Length = 3433 Score = 29.6 bits (65), Expect = 6.6 Identities = 17/50 (34%), Positives = 23/50 (46%) Frame = -2 Query: 169 FRSTY*QGRPFGICGQMQEEAASSKYQDRHFCCCCYXGWRSAALIPKLMS 20 FR TY C Q + EA + +D CCCC G +P+L+S Sbjct: 2198 FRGTY--------CQQREVEAITEDVEDNDGCCCCDPGH-----LPQLLS 2234 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 86,032,588 Number of Sequences: 219361 Number of extensions: 1758098 Number of successful extensions: 4057 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 3960 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4057 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4986986160 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)