| Clone Name | bags7p13 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ATG26_LEPMC (Q8NJS1) Sterol 3-beta-glucosyltransferase (EC 2.4.1... | 32 | 1.6 | 2 | Y1582_METJA (Q58977) Putative deoxyribonuclease MJ1582 (EC 3.1.2... | 31 | 2.1 | 3 | CI094_HUMAN (Q496M8) Protein C9orf94 precursor | 31 | 2.7 | 4 | IDUA_MOUSE (P48441) Alpha-L-iduronidase precursor (EC 3.2.1.76) | 30 | 6.0 | 5 | CBRC_DICD3 (Q47086) Achromobactin transport system permease prot... | 29 | 7.8 |
|---|
>ATG26_LEPMC (Q8NJS1) Sterol 3-beta-glucosyltransferase (EC 2.4.1.173)| (Autophagy-related protein 26) (UDP-glycosyltransferase 51) Length = 1456 Score = 31.6 bits (70), Expect = 1.6 Identities = 12/40 (30%), Positives = 27/40 (67%), Gaps = 3/40 (7%) Frame = +1 Query: 295 LQKKLQHHSKLFL---HLCIQTLKPTQESQVLFPMQATEN 405 LQ+ L ++ K+++ + C ++L PT +++++ PM+ EN Sbjct: 796 LQRVLPNYGKIYISGRYFCFRSLMPTSKTKIILPMKDIEN 835
>Y1582_METJA (Q58977) Putative deoxyribonuclease MJ1582 (EC 3.1.21.-)| Length = 249 Score = 31.2 bits (69), Expect = 2.1 Identities = 16/46 (34%), Positives = 25/46 (54%) Frame = +1 Query: 274 HIISRNVLQKKLQHHSKLFLHLCIQTLKPTQESQVLFPMQATENSP 411 H+IS + L +HH KL L ++ L +S L P++ T+N P Sbjct: 167 HLISISTLVCFSEHHKKLVESLDLEYLTTETDSPYLSPIKGTKNEP 212
>CI094_HUMAN (Q496M8) Protein C9orf94 precursor| Length = 467 Score = 30.8 bits (68), Expect = 2.7 Identities = 15/38 (39%), Positives = 18/38 (47%), Gaps = 1/38 (2%) Frame = -2 Query: 453 EACQALPLXQPSQ-AWTVLCGLHWEQYL*FLCRLQCLN 343 E C ALP +Q W+ C +HW L LC C N Sbjct: 352 EQCSALPRPVSTQNCWSEACSVHWRVSLWTLCTATCGN 389
>IDUA_MOUSE (P48441) Alpha-L-iduronidase precursor (EC 3.2.1.76)| Length = 634 Score = 29.6 bits (65), Expect = 6.0 Identities = 17/55 (30%), Positives = 24/55 (43%) Frame = +1 Query: 286 RNVLQKKLQHHSKLFLHLCIQTLKPTQESQVLFPMQATENSPSLGWLXQRKSLTC 450 R L +KL S L +H+C + LKP + L + T L W +R C Sbjct: 513 RLTLHRKLPVPSLLLVHVCTRPLKPPGQVSRLRALPLTHGQLILVWSDERVGSKC 567
>CBRC_DICD3 (Q47086) Achromobactin transport system permease protein cbrC| Length = 349 Score = 29.3 bits (64), Expect = 7.8 Identities = 14/38 (36%), Positives = 22/38 (57%) Frame = +3 Query: 306 ATTSFKVIPPPVHSDTEAYTGITGTVPNAGHREQSKLG 419 A T+F ++ P+ + AY +TG+V A RE +LG Sbjct: 180 AATTFMLVFSPLTTTLSAYVWLTGSVYGASWRETRELG 217 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 77,929,515 Number of Sequences: 219361 Number of extensions: 1543067 Number of successful extensions: 3745 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 3630 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3743 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4528412720 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)