| Clone Name | bags7p08 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ATPQ_ARATH (Q9FT52) ATP synthase D chain, mitochondrial (EC 3.6.... | 146 | 1e-35 | 2 | YTDC1_RAT (Q9QY02) YTH domain-containing protein 1 (Putative spl... | 30 | 2.9 | 3 | AATF_RAT (Q9QYW0) Protein AATF (Apoptosis-antagonizing transcrip... | 30 | 3.8 | 4 | HEATR_CAEEL (Q23495) Hypothetical protein ZK430.1 in chromosome II | 29 | 6.5 | 5 | SMYD5_XENLA (Q6GPQ4) SET and MYND domain-containing protein 5 | 29 | 6.5 | 6 | BFR2_ASPFU (Q4WMI1) Protein bfr2 | 29 | 8.5 |
|---|
>ATPQ_ARATH (Q9FT52) ATP synthase D chain, mitochondrial (EC 3.6.3.14)| Length = 167 Score = 146 bits (368), Expect(2) = 1e-35 Identities = 72/101 (71%), Positives = 77/101 (76%) Frame = +3 Query: 21 QKGIGSKVVDMYKEAYDSIEIPKYVDTVTPRYKPKFDALLVELKEAEKTSLKESXXXXXX 200 +KGIG+ +VD YKEAYDSIEIPKYVD VTP YKPKFDALLVELKEAE+ SLKES Sbjct: 67 RKGIGAGIVDKYKEAYDSIEIPKYVDKVTPEYKPKFDALLVELKEAEQKSLKESERLEKE 126 Query: 201 XXXXXXXXXXXSTMTADEYFAKHPELKKKFDDEMRNDYWGY 323 STMTADEYF KHPELKKKFDDE+RND WGY Sbjct: 127 IADVQEISKKLSTMTADEYFEKHPELKKKFDDEIRNDNWGY 167 Score = 22.7 bits (47), Expect(2) = 1e-35 Identities = 7/8 (87%), Positives = 8/8 (100%) Frame = +1 Query: 4 IDWEYYRK 27 IDW+YYRK Sbjct: 61 IDWDYYRK 68
>YTDC1_RAT (Q9QY02) YTH domain-containing protein 1 (Putative splicing factor| YT521) (RA301-binding protein) Length = 738 Score = 30.4 bits (67), Expect = 2.9 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = +2 Query: 149 EGGREDISEGIREDREGDC*NEGDEEKDQHND 244 EGG ED+ E D +GD E DE+ ++ D Sbjct: 202 EGGEEDVEEDEEVDEDGDDDEEVDEDAEEEED 233
>AATF_RAT (Q9QYW0) Protein AATF (Apoptosis-antagonizing transcription factor)| Length = 523 Score = 30.0 bits (66), Expect = 3.8 Identities = 15/37 (40%), Positives = 25/37 (67%) Frame = +2 Query: 149 EGGREDISEGIREDREGDC*NEGDEEKDQHNDSRRVL 259 EG E+ISE + ED EG+ +E D E+D++++ V+ Sbjct: 139 EGLEEEISEDVEEDLEGE--DEEDREEDRNSEDDGVV 173
>HEATR_CAEEL (Q23495) Hypothetical protein ZK430.1 in chromosome II| Length = 1650 Score = 29.3 bits (64), Expect = 6.5 Identities = 17/54 (31%), Positives = 28/54 (51%) Frame = +3 Query: 15 ILQKGIGSKVVDMYKEAYDSIEIPKYVDTVTPRYKPKFDALLVELKEAEKTSLK 176 ILQ+G+ + D K+ +I + R+ +FDA+ ELK +K +LK Sbjct: 398 ILQEGMDGNIFDNKKKLKSNIR------AIGMRFAKQFDAIHAELKAKDKKTLK 445
>SMYD5_XENLA (Q6GPQ4) SET and MYND domain-containing protein 5| Length = 421 Score = 29.3 bits (64), Expect = 6.5 Identities = 18/55 (32%), Positives = 31/55 (56%), Gaps = 1/55 (1%) Frame = +3 Query: 9 LGILQKGIGSKVVDMYKEAYDSIEIPKYVDTVTPRYKPKFDALLVEL-KEAEKTS 170 +G +GIG+ + + A D++E+P PR + K DAL+ +L K+ EK + Sbjct: 248 VGTNGQGIGTSSLSQWVHACDALELP-------PRDREKLDALIDQLYKDIEKVT 295
>BFR2_ASPFU (Q4WMI1) Protein bfr2| Length = 565 Score = 28.9 bits (63), Expect = 8.5 Identities = 15/47 (31%), Positives = 24/47 (51%), Gaps = 11/47 (23%) Frame = +2 Query: 149 EGGREDISEGIRED-----------REGDC*NEGDEEKDQHNDSRRV 256 EG +D +G ED +EGD + DE++D+ D+R+V Sbjct: 165 EGSEDDSEDGFDEDDMSGEFSSDDDQEGDEDGDDDEDEDEETDNRKV 211 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 63,676,956 Number of Sequences: 219361 Number of extensions: 1142079 Number of successful extensions: 3450 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 3342 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3444 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3754426130 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)