| Clone Name | bags8d20 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | MYCN_MARMO (Q61976) N-myc proto-oncogene protein (N-myc1) | 32 | 0.35 | 2 | PTW3C_BACSU (P39816) Putative PTS system glucosamine-specific EI... | 29 | 3.8 |
|---|
>MYCN_MARMO (Q61976) N-myc proto-oncogene protein (N-myc1)| Length = 460 Score = 32.3 bits (72), Expect = 0.35 Identities = 20/40 (50%), Positives = 23/40 (57%) Frame = -2 Query: 143 APAVGAAVAYLEEPAKSSRVPSILVGASAAIASSPRLGGR 24 +PAVGAAVA PA SAA+A+ PRLGGR Sbjct: 211 SPAVGAAVAGAAAPA------------SAAVAAPPRLGGR 238
>PTW3C_BACSU (P39816) Putative PTS system glucosamine-specific EIICBA component| [Includes: Glucosamine permease IIC component (PTS system glucosamine-specific EIIC component); Glucosamine-specific phosphotransferase enzyme IIB component (EC 2.7.1.69) (PTS Length = 631 Score = 28.9 bits (63), Expect = 3.8 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = -2 Query: 152 IFCAPAVGAAVAYLEEPAKSSRVPSILVGAS 60 IFC PAV A+ + P K + +++ A+ Sbjct: 252 IFCLPAVALAIIHTARPEKKKMISGVMISAA 282 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 22,991,000 Number of Sequences: 219361 Number of extensions: 329702 Number of successful extensions: 1221 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1207 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1220 length of database: 80,573,946 effective HSP length: 46 effective length of database: 70,483,340 effective search space used: 1691600160 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)