| Clone Name | bags8c22 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | PRAM2_HUMAN (O60811) PRAME family member 2 | 31 | 2.5 | 2 | PRAM1_HUMAN (O95521) PRAME family member 1 | 31 | 2.5 | 3 | VMSA_WHV8 (P17400) Major surface antigen precursor | 31 | 2.5 | 4 | VMSA_WHV7 (P12909) Major surface antigen precursor | 31 | 2.5 | 5 | VMSA_WHV59 (P12910) Major surface antigen precursor | 31 | 2.5 | 6 | VMSA_WHV2 (P06432) Major surface antigen precursor | 31 | 2.5 | 7 | VMSA_WHVW6 (P11293) Major surface antigen precursor | 31 | 2.5 | 8 | VMSA_WHV1 (P03143) Major surface antigen precursor | 31 | 2.5 | 9 | RIR2_CHLPN (Q9Z6S4) Ribonucleoside-diphosphate reductase beta su... | 29 | 9.5 |
|---|
>PRAM2_HUMAN (O60811) PRAME family member 2| Length = 474 Score = 31.2 bits (69), Expect = 2.5 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = +3 Query: 60 VGEVPCPGCGADADQRISRHLC 125 +G PCP CG+ + + HLC Sbjct: 452 IGPTPCPSCGSSPSEELELHLC 473
>PRAM1_HUMAN (O95521) PRAME family member 1| Length = 474 Score = 31.2 bits (69), Expect = 2.5 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = +3 Query: 60 VGEVPCPGCGADADQRISRHLC 125 +G PCP CG+ + + HLC Sbjct: 452 IGPTPCPSCGSSPSEELELHLC 473
>VMSA_WHV8 (P17400) Major surface antigen precursor| Length = 431 Score = 31.2 bits (69), Expect = 2.5 Identities = 13/40 (32%), Positives = 23/40 (57%) Frame = +3 Query: 141 NMKFEGCPYVPAFCATMFKGQQNLLLVRFLAY*IVWVMCL 260 N +F+ C ++P C G + + L RF+ Y +V ++CL Sbjct: 259 NSQFQTCKHLPTSCPPTCNGFRWMYLRRFIIYLLVLLLCL 298
>VMSA_WHV7 (P12909) Major surface antigen precursor| Length = 431 Score = 31.2 bits (69), Expect = 2.5 Identities = 13/40 (32%), Positives = 23/40 (57%) Frame = +3 Query: 141 NMKFEGCPYVPAFCATMFKGQQNLLLVRFLAY*IVWVMCL 260 N +F+ C ++P C G + + L RF+ Y +V ++CL Sbjct: 259 NSQFQTCKHLPTSCPPTCNGFRWMYLRRFIIYLLVLLLCL 298
>VMSA_WHV59 (P12910) Major surface antigen precursor| Length = 431 Score = 31.2 bits (69), Expect = 2.5 Identities = 13/40 (32%), Positives = 23/40 (57%) Frame = +3 Query: 141 NMKFEGCPYVPAFCATMFKGQQNLLLVRFLAY*IVWVMCL 260 N +F+ C ++P C G + + L RF+ Y +V ++CL Sbjct: 259 NSQFQTCKHLPTSCPPTCNGFRWMYLRRFIIYLLVLLLCL 298
>VMSA_WHV2 (P06432) Major surface antigen precursor| Length = 431 Score = 31.2 bits (69), Expect = 2.5 Identities = 13/40 (32%), Positives = 23/40 (57%) Frame = +3 Query: 141 NMKFEGCPYVPAFCATMFKGQQNLLLVRFLAY*IVWVMCL 260 N +F+ C ++P C G + + L RF+ Y +V ++CL Sbjct: 259 NSQFQTCKHLPTSCPPTCNGFRWMYLRRFIIYLLVLLLCL 298
>VMSA_WHVW6 (P11293) Major surface antigen precursor| Length = 282 Score = 31.2 bits (69), Expect = 2.5 Identities = 13/40 (32%), Positives = 23/40 (57%) Frame = +3 Query: 141 NMKFEGCPYVPAFCATMFKGQQNLLLVRFLAY*IVWVMCL 260 N +F+ C ++P C G + + L RF+ Y +V ++CL Sbjct: 110 NSQFQTCKHLPTSCPPTCNGFRWMYLRRFIIYLLVLLLCL 149
>VMSA_WHV1 (P03143) Major surface antigen precursor| Length = 426 Score = 31.2 bits (69), Expect = 2.5 Identities = 13/40 (32%), Positives = 23/40 (57%) Frame = +3 Query: 141 NMKFEGCPYVPAFCATMFKGQQNLLLVRFLAY*IVWVMCL 260 N +F+ C ++P C G + + L RF+ Y +V ++CL Sbjct: 254 NSQFQTCKHLPTSCPPTCNGFRWMYLRRFIIYLLVLLLCL 293
>RIR2_CHLPN (Q9Z6S4) Ribonucleoside-diphosphate reductase beta subunit (EC| 1.17.4.1) (Ribonucleotide reductase small subunit) Length = 346 Score = 29.3 bits (64), Expect = 9.5 Identities = 15/36 (41%), Positives = 20/36 (55%) Frame = +2 Query: 332 CLP*GTQGLRTTQVAPHVKVIEDV*GAHIPLLPVYH 439 CLP G GLR++ +V+ I D I L P+YH Sbjct: 275 CLPRGILGLRSSMFIDYVRHIADRRLERIGLKPIYH 310 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 83,033,823 Number of Sequences: 219361 Number of extensions: 1632062 Number of successful extensions: 3345 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 3235 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3345 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5481822624 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)