| Clone Name | bags7m07 |
|---|---|
| Clone Library Name | barley_pub |
>LRC8A_RAT (Q4V8I7) Leucine-rich repeat-containing protein 8A| Length = 810 Score = 31.2 bits (69), Expect = 2.8 Identities = 22/63 (34%), Positives = 37/63 (58%), Gaps = 2/63 (3%) Frame = +2 Query: 29 KLMHLLAGNAKLPSGINKMKL-LLTLSCSNIGKSTDTNIIQELSEMVSLTELELF-CNVT 202 K++ L + +KLP + + + L LS +N G T ++ L +MV+LTELEL C++ Sbjct: 547 KVLRLKSNLSKLPQVVTDVGVHLQKLSINNEG--TKLIVLNSLKKMVNLTELELIRCDLE 604 Query: 203 QAP 211 + P Sbjct: 605 RIP 607
>LRC8A_MOUSE (Q80WG5) Leucine-rich repeat-containing protein 8A| Length = 810 Score = 31.2 bits (69), Expect = 2.8 Identities = 22/63 (34%), Positives = 37/63 (58%), Gaps = 2/63 (3%) Frame = +2 Query: 29 KLMHLLAGNAKLPSGINKMKL-LLTLSCSNIGKSTDTNIIQELSEMVSLTELELF-CNVT 202 K++ L + +KLP + + + L LS +N G T ++ L +MV+LTELEL C++ Sbjct: 547 KVLRLKSNLSKLPQVVTDVGVHLQKLSINNEG--TKLIVLNSLKKMVNLTELELIRCDLE 604 Query: 203 QAP 211 + P Sbjct: 605 RIP 607
>LAP1_CAEEL (O61967) Protein lap1 (Protein lethal-413)| Length = 699 Score = 31.2 bits (69), Expect = 2.8 Identities = 37/128 (28%), Positives = 57/128 (44%), Gaps = 3/128 (2%) Frame = +2 Query: 56 AKLPSGINKMKLLLTLSCSNIGKSTDTNIIQELSEMVSLTELELFCNVTQAPGDKKQVAF 235 AKLP + KLL TL N+ + T + + + E S+T L L + Sbjct: 95 AKLPDTMQNCKLLTTL---NLSSNPFTRLPETICECSSITILSL--------NETSLTLL 143 Query: 236 PS--GGFRSLKKLSIRCSLLSVTFVTDALSKVEVLEL-KFEEGHSEESRGVSGIQHLTGL 406 PS G +L+ L R +LL T LS VE+ +L + + G +E + I LT L Sbjct: 144 PSNIGSLTNLRVLEARDNLLR----TIPLSIVELRKLEELDLGQNELEALPAEIGKLTSL 199 Query: 407 KHMIVEFS 430 + V+ + Sbjct: 200 REFYVDIN 207
>COPG_BOVIN (P53620) Coatomer subunit gamma (Gamma-coat protein) (Gamma-COP)| Length = 874 Score = 30.0 bits (66), Expect = 6.2 Identities = 18/54 (33%), Positives = 27/54 (50%) Frame = -2 Query: 416 SYASGLSDAVCQTHPSTPLNGLLQTLAQALQPSIKHRSQRSLIASCTLLKAS*D 255 SY A+CQ ST L + + + QA+ + S +L++S LLK S D Sbjct: 119 SYRGPAVRALCQITDSTMLQAIERYMKQAIVDKVPSVSSSALVSSLHLLKCSFD 172
>PBL1F_EUGGR (P84742) Photoactivated adenylate cyclase beta-subunit-like protein| 1224-5/1F Length = 859 Score = 29.6 bits (65), Expect = 8.0 Identities = 14/40 (35%), Positives = 22/40 (55%) Frame = +2 Query: 77 NKMKLLLTLSCSNIGKSTDTNIIQELSEMVSLTELELFCN 196 N + L+ +SC + +TD L+E SLTE+ + CN Sbjct: 607 NNRRNLMPVSCGVVMLATDIGSFTSLTEESSLTEVWMICN 646
>LRC8A_HUMAN (Q8IWT6) Leucine-rich repeat-containing protein 8A| Length = 810 Score = 29.6 bits (65), Expect = 8.0 Identities = 21/63 (33%), Positives = 36/63 (57%), Gaps = 2/63 (3%) Frame = +2 Query: 29 KLMHLLAGNAKLPSGINKMKL-LLTLSCSNIGKSTDTNIIQELSEMVSLTELELF-CNVT 202 K++ L + +KLP + + + L LS +N G T ++ L +M +LTELEL C++ Sbjct: 547 KVLRLKSNLSKLPQVVTDVGVHLQKLSINNEG--TKLIVLNSLKKMANLTELELIRCDLE 604 Query: 203 QAP 211 + P Sbjct: 605 RIP 607
>TDRD7_HUMAN (Q8NHU6) Tudor domain-containing protein 7 (Tudor repeat associator| with PCTAIRE 2) (Trap) Length = 1098 Score = 29.6 bits (65), Expect = 8.0 Identities = 22/80 (27%), Positives = 37/80 (46%), Gaps = 10/80 (12%) Frame = -3 Query: 607 YITSGHRSCLLGIRCVQ--CSKTLFVDLLINAHDDHLTIRVDLLSNLLYCRSCC---CRI 443 Y TSG + C++ C K+L V L ++A ++ + LYC+ C ++ Sbjct: 620 YDTSGEDDININATCLKAICDKSLEVHLQVDAMYTNVKVTNICSDGTLYCQVPCKGLNKL 679 Query: 442 RIMLRKLDD-----HMLQAC 398 +LRK++D HM C Sbjct: 680 SDLLRKIEDYFHCKHMTSEC 699 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 77,724,190 Number of Sequences: 219361 Number of extensions: 1302422 Number of successful extensions: 3792 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 3712 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3792 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6086476506 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)