| Clone Name | bags7k24 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | VE2_HPV36 (P50809) Regulatory protein E2 | 33 | 0.93 | 2 | PI2R_BOVIN (P79393) Prostacyclin receptor (Prostanoid IP recepto... | 31 | 3.5 | 3 | MUC2_RAT (Q62635) Mucin-2 precursor (Intestinal mucin 2) (Fragment) | 30 | 6.0 |
|---|
>VE2_HPV36 (P50809) Regulatory protein E2| Length = 509 Score = 32.7 bits (73), Expect = 0.93 Identities = 30/105 (28%), Positives = 45/105 (42%), Gaps = 1/105 (0%) Frame = -1 Query: 373 DPASKHAAATRKVSHEKRKSMRAQAREPPGLSPRPQQKHRLASMTTTCAAVRRRS-APTP 197 D +K + + + K R R P + RPQ K R + + R RS + + Sbjct: 227 DSTTKQLTTSEQPQQTETKG-RKYGRRPSSRTRRPQAKQRRSRSRHRSSRSRSRSQSRSH 285 Query: 196 *PVATSES*TQ*SYSLARSGVTVALLRRCSAATARPKAMRLRSRA 62 P S + S SLA++GV R S +T+R R RSR+ Sbjct: 286 TPTTRSATTRSRSPSLAKTGVQRVSTRSRSRSTSRRGGRRRRSRS 330
>PI2R_BOVIN (P79393) Prostacyclin receptor (Prostanoid IP receptor) (PGI| receptor) (Prostaglandin I2 receptor) Length = 385 Score = 30.8 bits (68), Expect = 3.5 Identities = 21/51 (41%), Positives = 25/51 (49%) Frame = +3 Query: 252 SRCFCCGRGLKPGGSRACALMLFLFSWLTFLVAAACLLAGSVRNAYHTRYR 404 S CF R +PGG CA +L S + LVAA L GSV + YR Sbjct: 168 SWCFIRMRSAEPGG---CAFLLAYASLVALLVAAIVLCNGSVTLSLCRMYR 215
>MUC2_RAT (Q62635) Mucin-2 precursor (Intestinal mucin 2) (Fragment)| Length = 1513 Score = 30.0 bits (66), Expect = 6.0 Identities = 21/96 (21%), Positives = 38/96 (39%) Frame = -1 Query: 454 TPLRSVSQESGSPLKIPLYRVWYALRTDPASKHAAATRKVSHEKRKSMRAQAREPPGLSP 275 TP+ S Q + SP +P + T P + H +T + S + P + Sbjct: 1397 TPISSTPQPTSSPTTLPTTSPLTSSATSPTTSHITSTVSPTTSPTTSTTSPTTSPTTSTT 1456 Query: 274 RPQQKHRLASMTTTCAAVRRRSAPTP*PVATSES*T 167 P ++ + T + ++PTP P ++ S T Sbjct: 1457 SP----TTSTTSPTPSPTTSTTSPTPSPTTSTTSPT 1488 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 68,913,658 Number of Sequences: 219361 Number of extensions: 1190421 Number of successful extensions: 4819 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4616 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4813 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 5972710590 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)