| Clone Name | bags7d22 |
|---|---|
| Clone Library Name | barley_pub |
>SIR_SYNY3 (P72854) Sulfite reductase [ferredoxin] (EC 1.8.7.1)| Length = 635 Score = 31.6 bits (70), Expect = 1.9 Identities = 13/21 (61%), Positives = 15/21 (71%) Frame = +1 Query: 172 DVVVNMLRFHGSYQLDQMDNR 234 D V +L+FHGSYQ D DNR Sbjct: 42 DDAVQILKFHGSYQQDNRDNR 62
>CYSI_BUCAI (P57502) Sulfite reductase [NADPH] hemoprotein beta-component (EC| 1.8.1.2) (SIR-HP) (SIRHP) Length = 569 Score = 30.8 bits (68), Expect = 3.3 Identities = 17/59 (28%), Positives = 30/59 (50%), Gaps = 5/59 (8%) Frame = +1 Query: 85 QKKLINLQIVENDDDYWNG-----LSAALSVGWLDVVVNMLRFHGSYQLDQMDNRETEN 246 +KKL + + ++ + +Y G L ++ G+ +++RFHG YQ D D R N Sbjct: 11 EKKLTDAERIKENSNYLRGTITDDLKNEITNGFTGDNFSLIRFHGMYQQDDRDLRIERN 69
>ATG12_NEUCR (Q7S083) Autophagy-related protein 12 (Autophagy-related| ubiquitin-like modifier atg-12) Length = 157 Score = 30.8 bits (68), Expect = 3.3 Identities = 19/61 (31%), Positives = 32/61 (52%), Gaps = 4/61 (6%) Frame = -2 Query: 516 FQPMGSSSS----EVLYISQHDVKQILQTITSFLVTALNPKCTALQFTYLTSPFFPCLDE 349 F+P+GS+ + +V +S H +T+ ++L L + T F Y+ S F P LDE Sbjct: 75 FKPVGSAPALRREQVKVLSTHS----FETVVAYLRKTLKVQETDSVFLYVNSVFAPALDE 130 Query: 348 I 346 + Sbjct: 131 V 131
>PT1_BORBU (O51508) Phosphoenolpyruvate-protein phosphotransferase (EC| 2.7.3.9) (Phosphotransferase system, enzyme I) Length = 573 Score = 30.4 bits (67), Expect = 4.3 Identities = 18/56 (32%), Positives = 29/56 (51%), Gaps = 3/56 (5%) Frame = +1 Query: 388 KLECSAFWIQCSHQKTRDGLKNLLHIMLGNIKDLTAATSHWLE---LFASHFLYIR 546 +LE F ++ +T+DG K L +G D+T + +E LF + FLY+R Sbjct: 249 ELEKELFSLKDKDAETKDGTKVFLKANIGTPVDITYVNKYGVEGIGLFRTEFLYMR 304
>SIR_SYNP7 (P30008) Sulfite reductase [ferredoxin] (EC 1.8.7.1)| Length = 624 Score = 30.0 bits (66), Expect = 5.6 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = +1 Query: 181 VNMLRFHGSYQLDQMDNR 234 + +L+FHGSYQ D DNR Sbjct: 43 IQILKFHGSYQQDNRDNR 60
>APAH_BUCAI (P57242) Bis(5'-nucleosyl)-tetraphosphatase, symmetrical (EC| 3.6.1.41) (Diadenosine tetraphosphatase) (Ap4A hydrolase) (Diadenosine 5',5'''-P1,P4-tetraphosphate pyrophosphohydrolase) Length = 274 Score = 29.6 bits (65), Expect = 7.3 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +1 Query: 274 VSTMPRMRPDLPKGKLGQCCKTRPDFIK 357 +++ RMR P G+L CK PDF+K Sbjct: 177 MNSFTRMRYCYPDGRLNMFCKKSPDFVK 204
>NIFB_AZOVI (P11067) FeMo cofactor biosynthesis protein nifB| Length = 502 Score = 29.6 bits (65), Expect = 7.3 Identities = 16/60 (26%), Positives = 26/60 (43%) Frame = -1 Query: 232 GCPSDPIGMIHENVAYSPRHQAIQLTVLPIIHSSNHHHFQQSAG*LAFFGNY*ACNTPCH 53 GC S G H+ +++ P + ++ P HH+F + +A ACN CH Sbjct: 18 GCSSSSCGSTHDQLSHLPENIRAKVQNHPCYSEEAHHYFARMHVAVA-----PACNIQCH 72
>ATG12_DEBHA (Q6BU30) Autophagy-related protein 12 (Autophagy-related| ubiquitin-like modifier ATG12) Length = 153 Score = 29.3 bits (64), Expect = 9.6 Identities = 19/56 (33%), Positives = 30/56 (53%) Frame = -2 Query: 516 FQPMGSSSSEVLYISQHDVKQILQTITSFLVTALNPKCTALQFTYLTSPFFPCLDE 349 FQP+GS+ S + + Q + TI+ FL+ L K + L + Y+ + F P DE Sbjct: 73 FQPIGSTPSINPRVFKISSNQSISTISKFLIKRLKIK-SNLIYLYIQNSFQPNPDE 127 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 93,212,821 Number of Sequences: 219361 Number of extensions: 2029801 Number of successful extensions: 4661 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 4548 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4661 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5538924943 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)